Recombinant Escherichia coli O81 Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
yidC; ECED1_4397; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
yidC
Target Protein Sequence
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV QNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL HSREKKKS
Uniprot No.

Target Background

Function
YidC is a membrane protein insertase in Escherichia coli. It plays a crucial role in the insertion and proper folding of integral membrane proteins into the membrane. This protein is involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of E. coli YidC?

YidC is a 61 kDa integral membrane protein in E. coli that functions as a membrane insertase, catalyzing the integration of newly synthesized proteins into the lipid bilayer. The protein contains 6 transmembrane segments and has a large periplasmic domain between the first two transmembrane regions . YidC is evolutionarily related to the mitochondrial Oxa1p and the chloroplast Alb3 protein .

The primary function of YidC is to recognize hydrophobic regions of membrane proteins and facilitate their proper orientation within the membrane bilayer. YidC can operate both independently for Sec-independent substrates and in conjunction with the Sec translocase (SecYEGDF) for Sec-dependent membrane proteins .

How does YidC interact with substrate proteins during membrane insertion?

YidC interacts with substrate proteins through several stages:

  • Recognition of hydrophobic domains: YidC recognizes transmembrane segments of the substrate protein

  • Facilitation of membrane integration: YidC catalyzes the insertion of these hydrophobic regions into the lipid bilayer

  • Sequential processing: For Sec-dependent proteins like FtsQ, nascent chains first contact SecY and then YidC, demonstrating a coordinated handoff process

  • Chaperone function: YidC helps maintain the proper folding of polytopic membrane proteins during insertion

Experimental data from in vitro cross-linking studies show that YidD, a protein encoded by a gene adjacent to yidC, is also in proximity to nascent inner membrane proteins during their localization in the Sec-YidC translocon, suggesting multiple protein interactions during the insertion process .

What are the differences between Sec-dependent and Sec-independent YidC substrates?

FeatureSec-Dependent SubstratesSec-Independent Substrates
Insertion PathwayRequires SecYEG translocaseRequires only YidC
Typical ExamplesFtsQ (cell division protein)Pf3 coat protein, M13 procoat
Periplasmic Domain SizeOften large periplasmic domainsSmall or minimal periplasmic domains
ATP RequirementOften requires SecA/ATP hydrolysisNo ATP requirement
YidC FunctionWorks with Sec machineryWorks independently
Cross-linking PatternSequential contact with SecY then YidCDirect contact with YidC

Notably, the Pf3 coat protein can be efficiently inserted into proteoliposomes containing purified YidC without the Sec machinery, conclusively demonstrating YidC's independent insertase activity .

How can YidC be purified and reconstituted into proteoliposomes for functional studies?

The purification and reconstitution of YidC involves several critical steps:

  • Expression and purification:

    • Engineer YidC with a C-terminal hexahistidine tag for affinity purification

    • Purify using affinity chromatography followed by ion exchange chromatography

    • Verify purity by SDS-PAGE analysis

  • Proteoliposome preparation:

    • Create a dry film of E. coli lipids

    • Rehydrate the lipid film in 100 mM Na₂SO₄, HEPES (pH 8.0) buffer

    • Mix with purified YidC protein

    • Pass through an extruder to obtain proteoliposomes of approximately 0.25 μm diameter

    • Collect proteoliposomes by centrifugation

    • Resuspend in 100 mM K₂SO₄

  • Orientation analysis:

    • Treat proteoliposomes with trypsin

    • Analyze trypsin-resistant fragments by SDS-PAGE and immunoblotting

    • Identify fragments using domain-specific antibodies (periplasmic domain vs. C-terminal region)

    • The appearance of a 42 kDa trypsin-resistant fragment recognized by periplasmic domain antibodies indicates inverted orientation with the periplasmic domain inside the vesicles

This reconstitution system provides a powerful tool for studying YidC-mediated insertion in a controlled environment free from other cellular components.

What methods can be used to monitor YidC-mediated membrane protein insertion in vivo and in vitro?

Researchers employ multiple complementary approaches to study YidC-mediated insertion:

In vivo methods:

  • YidC depletion studies:

    • Use strains like JS7131 with arabinose-regulated YidC expression

    • Monitor accumulation of substrate proteins in cytoplasm vs. membrane fractions

    • Analyze by immunoblotting or pulse-chase experiments

  • Genetic complementation:

    • Test whether mutant YidC constructs can restore growth in YidC-depleted cells

    • Analyze insertion efficiency of model substrates

  • In vivo cross-linking:

    • Incorporate photoactivatable or chemical cross-linkers into substrates

    • Identify interaction partners by immunoprecipitation and mass spectrometry

In vitro methods:

  • Reconstituted proteoliposome assays:

    • Mix purified substrate proteins with YidC-containing proteoliposomes

    • Monitor insertion by protease protection assays

    • Quantify by SDS-PAGE and phosphorimaging

  • Binding assays:

    • Measure direct binding between purified YidC and substrate proteins

    • Assess whether multiple substrates can bind simultaneously to dimeric YidC

  • Real-time insertion monitoring:

    • Use fluorescence-based techniques to track insertion kinetics

    • Compare insertion rates with and without YidC

    • Study the impact of mutations on insertion efficiency

How can researchers create and verify YidC depletion strains for functional studies?

Creating effective YidC depletion strains requires careful genetic manipulation:

  • Conditional expression system construction:

    • Replace the native yidC promoter with an inducible promoter (e.g., araBAD)

    • Verify construct by PCR and sequencing

    • Transform into appropriate E. coli strain

  • Depletion protocol:

    • Grow cells initially in inducer-containing medium

    • Wash cells thoroughly to remove inducer

    • Transfer to medium without inducer

    • Monitor YidC levels by western blotting at different time points

  • Phenotypic verification:

    • Growth curve analysis in permissive vs. non-permissive conditions

    • Microscopic examination for morphological changes

    • Biochemical assessment of known YidC substrates

  • Alternative gene inactivation approaches:

    • For non-essential genes like yidD, direct gene knockout can be performed using the Datsenko and Wanner method

    • Amplify a kanamycin resistance cassette using primers with homology to flanking regions

    • Transform into cells expressing the Red recombination system

    • Select for kanamycin-resistant colonies

    • Verify proper inactivation by PCR

When working with essential genes like yidC, researchers must ensure tight regulation of expression and confirm depletion efficiency before conducting functional experiments.

How does the oligomeric state of YidC affect its function as a membrane insertase?

YidC can exist in different oligomeric states, which has important implications for its function:

  • Monomeric vs. dimeric forms:

    • YidC can be found as a monomer, dimer, or as part of the SecYEGDF-YajC-YidC holotranslocase

    • Research using artificially dimerized YidC (two copies connected by a linker peptide) shows that the 120 kDa dimeric construct is stable and fully functional

  • Functional independence of protomers:

    • Each protomer in a dimeric YidC appears to function independently

    • Introducing inactivating mutations into one protomer does not abolish the function of the dimeric construct

    • Only when both protomers are defective do substrate proteins accumulate in the cytoplasm

  • Substrate binding capacity:

    • Dimeric YidC can bind two substrate proteins simultaneously

    • This provides strong evidence that each YidC protomer functions as a discrete insertase unit

  • Implications for in vivo function:

    • The ability of YidC to function as either a monomer or dimer suggests flexibility in membrane protein insertion mechanisms

    • The cooperative binding of YidC with other components like the Sec machinery may influence its oligomeric state

These findings suggest that while YidC can exist as a dimer, each protomer functions as an independent insertion unit rather than requiring cooperation between protomers for a single substrate.

What is the relationship between YidC and other membrane protein biogenesis factors like YidD?

YidC operates within a complex network of membrane protein biogenesis factors:

  • Genomic organization:

    • The yidC gene is located in a highly conserved gene cluster in Gram-negative bacteria

    • The gene order is rpmH, rnpA, yidD, yidC, and trmE

    • yidD overlaps with rnpA and is positioned just 2 bp upstream of yidC

    • This arrangement suggests potential functional relationships and co-regulation

  • YidD characterization:

    • YidD is expressed and localizes to the inner membrane

    • It likely inserts through an amphipathic helix

    • Unlike YidC, YidD is not essential for cell growth and viability

  • Functional relationship:

    • ΔyidD cells show defects in insertion and processing of YidC-dependent inner membrane proteins

    • In vitro cross-linking experiments demonstrate that YidD is in proximity to nascent inner membrane proteins during localization in the Sec-YidC translocon

    • This suggests YidD may play an auxiliary role in the insertion process

  • Holotranslocase interactions:

    • Under certain conditions, YidC can form a large complex with SecYEG, SecDF, and YajC

    • In this Sec holo-translocon, the peripheral SecA protein may participate using ATP hydrolysis to promote translocation of large periplasmic domains

    • The specific interactions between YidC and these components are still being elucidated

This network of interactions highlights the complexity of membrane protein biogenesis and the integrated nature of insertion pathways.

How do mutations in YidC affect its insertase activity for different substrate proteins?

YidC mutations have differential effects on various substrate proteins, revealing important structure-function relationships:

Understanding the molecular basis for these substrate-specific effects remains an active area of research and would benefit from structural studies of YidC-substrate complexes.

How can researchers reconcile contradictory findings regarding YidC's role in membrane protein insertion?

When faced with contradictory findings about YidC function, researchers should consider several methodological and biological factors:

  • Experimental system differences:

    • In vitro vs. in vivo approaches may yield different results

    • Reconstituted systems may lack auxiliary factors present in cells

    • Compare proteoliposome composition, buffer conditions, and protein purification methods between studies

  • Substrate-specific requirements:

    • Different substrate proteins may have varying dependencies on YidC

    • For example, the Pf3 coat protein with an extended hydrophobic region can insert independently of YidC, but insertion is accelerated by YidC

    • Systematically test multiple substrate proteins to identify patterns

  • YidC depletion efficiency:

    • Incomplete YidC depletion may lead to residual insertion activity

    • Verify depletion levels by quantitative western blotting

    • Consider the time course of depletion and potential adaptation mechanisms

  • Redundant insertion pathways:

    • Some proteins may use both YidC-dependent and YidC-independent pathways

    • Under YidC depletion, alternative pathways may compensate

    • Test for synthetic phenotypes with mutations in alternative pathways

  • Strain-specific differences:

    • Different E. coli strains may show variations in membrane protein insertion efficiency

    • Standardize genetic backgrounds when comparing results across studies

    • Consider repeating key experiments in multiple strain backgrounds

When analyzing contradictory data, perform careful controls and consider quantitative rather than qualitative assessments of insertion efficiency.

What are the quantitative parameters for measuring YidC-mediated insertion efficiency?

Precise quantification of YidC activity requires standardized parameters:

ParameterMeasurement MethodTypical ValuesConsiderations
Insertion rateReal-time fluorescence or radiolabeling0.1-10 molecules/min/YidCTemperature-dependent
Binding affinity (Kd)Equilibrium binding assays0.1-10 μM rangeDependent on detergent/lipid environment
Catalytic efficiency (kcat/KM)Initial rate kineticsVariable by substrateRequires purified components
Insertion yieldProtease protection assays40-90% of input proteinTime-dependent
Orientation accuracyProtease accessibility mapping>90% correct orientationSubstrate-dependent

When measuring insertion into proteoliposomes:

  • Use rigorously standardized proteoliposome preparations

  • Verify YidC orientation and concentration in each preparation

  • Control for spontaneous insertion through parallel experiments with protein-free liposomes

  • Consider the impact of lipid composition on insertion efficiency

  • Account for time-dependent effects as insertion may continue over extended periods

These quantitative approaches allow for meaningful comparisons between different experimental conditions and substrate proteins.

How can researchers distinguish between YidC's roles in membrane protein insertion versus folding and assembly?

Differentiating YidC's insertion and folding functions requires sophisticated experimental approaches:

  • Temporal separation of insertion and folding:

    • Use pulse-chase experiments to track the timeline of membrane integration versus attainment of proper conformation

    • Compare wild-type YidC to mutants that may selectively affect either insertion or folding

  • Insertion vs. folding assays:

    • Insertion: Measure protease protection of transmembrane domains

    • Folding: Monitor acquisition of functional activity or specific structural epitopes

    • Assembly: Track formation of oligomeric complexes by native gel electrophoresis

  • Structure-specific probes:

    • Use conformation-specific antibodies that recognize only correctly folded proteins

    • Apply chemical modification techniques that detect exposed residues

    • Employ distance measurements between specific residues using FRET or cross-linking

  • Trapped intermediates:

    • Engineer substrate proteins with mutations that arrest them at specific stages

    • Compare YidC interactions with these intermediates

    • Determine which steps are most affected by YidC depletion or mutation

Recent research demonstrates that YidC acts as a chaperone for the polytopic membrane protein MelB during its insertion and folding process . This chaperone function appears to be distinct from but complementary to YidC's primary insertase activity.

What are the current gaps in understanding YidC function and methodological approaches to address them?

Several significant knowledge gaps remain in YidC research:

  • Molecular mechanism of insertion:

    • Structural studies of YidC-substrate complexes during the insertion process

    • Single-molecule approaches to track conformational changes during insertion

    • Computational modeling of the insertion pathway

  • Substrate recognition determinants:

    • Systematic analysis of sequence/structural features recognized by YidC

    • Development of prediction algorithms for YidC dependency

    • Identification of consensus motifs in YidC-dependent proteins

  • Regulatory mechanisms:

    • Investigation of factors controlling YidC expression and activity

    • Understanding how cells respond to YidC limitation or stress

    • Elucidation of potential post-translational modifications affecting YidC function

  • Evolutionary aspects:

    • Comprehensive comparison of YidC homologs across bacterial species

    • Functional analysis of YidC in diverse bacteria with different membrane compositions

    • Understanding the evolutionary relationship between bacterial YidC, mitochondrial Oxa1p, and chloroplast Alb3

  • Methodological innovations needed:

    • Improved membrane protein reconstitution techniques

    • Development of high-throughput assays for YidC activity

    • Advanced imaging approaches to visualize insertion in real time

    • More sensitive methods to detect insertion intermediates

Addressing these gaps will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and computational methods.

How might research on YidC contribute to our understanding of membrane protein insertion disorders?

YidC research has broader implications for understanding membrane protein biogenesis disorders:

  • Relevance to mitochondrial diseases:

    • YidC is homologous to mitochondrial Oxa1p

    • Mutations in OXA1 cause mitochondrial diseases in humans

    • Mechanistic insights from bacterial YidC may inform understanding of Oxa1p function

  • Translational applications:

    • Development of systems to correctly insert challenging membrane proteins

    • Enhanced production of membrane proteins for structural studies

    • Potential therapeutic targets in bacteria-specific insertion pathways

  • Model for membrane protein quality control:

    • Understanding how cells handle membrane protein insertion defects

    • Elucidating connections between insertion failure and stress responses

    • Insights into cellular mechanisms preventing misfolded membrane protein accumulation

  • Antibiotic development implications:

    • YidC is essential in many bacteria and absent in humans

    • Represents a potential target for novel antimicrobials

    • Structure-based drug design targeting YidC could lead to new antibacterial strategies

YidC research thus connects fundamental bacterial membrane biology to broader biomedical applications, particularly in areas related to membrane protein biogenesis disorders and bacterial pathogenesis.

How do the various functions of YidC interconnect to maintain membrane proteostasis?

YidC serves as a central hub in membrane protein biogenesis through several interconnected functions:

  • Primary insertase activity: YidC directly catalyzes the insertion of Sec-independent membrane proteins like Pf3 coat protein into the lipid bilayer

  • Cooperative insertion with Sec machinery: YidC works with the Sec translocase to facilitate insertion of Sec-dependent membrane proteins, receiving transmembrane domains from the lateral gate of SecY

  • Chaperone function: YidC helps membrane proteins attain their proper folded structure, as demonstrated with the polytopic melibiose permease MelB

  • Assembly assistance: YidC may facilitate the assembly of multisubunit membrane protein complexes

  • Quality control participation: YidC likely coordinates with other factors to prevent misfolded membrane protein accumulation

These functions form an integrated system that ensures newly synthesized membrane proteins correctly enter the bilayer and achieve their functional states. The balance between these roles may vary depending on substrate properties and cellular conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.