Recombinant Escherichia coli O81 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
nuoK; ECED1_2743; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQV MYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG
Uniprot No.

Target Background

Function
NDH-1 (NADH-quinone oxidoreductase subunit K) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled with proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its functional role in E. coli?

NADH-quinone oxidoreductase subunit K (nuoK) is one of the membrane subunits of respiratory Complex I (NDH-I) in Escherichia coli. Complex I is a multi-subunit enzyme comprising 13-14 different subunits that contains flavin mononucleotide (FMN) and several iron-sulfur (Fe-S) clusters. This enzyme catalyzes the oxidation of NADH and reduction of ubiquinone, coupling this redox reaction with proton translocation across the bacterial membrane, thereby contributing to energy conservation .

E. coli possesses two distinct respiratory NADH dehydrogenases: NDH-I (Complex I, which includes nuoK) and NDH-II. While both can oxidize NADH, only Complex I couples this reaction to proton translocation. In E. coli, Complex I functions in both aerobic and anaerobic respiration, whereas NDH-II is repressed under anaerobic growth conditions . The nuoK subunit, as part of the membrane domain of Complex I, likely participates in the proton pumping mechanism that generates the proton motive force used for ATP synthesis.

What expression systems and conditions yield optimal production of recombinant nuoK protein?

Optimal expression of recombinant nuoK requires careful consideration of the expression system and conditions due to its nature as a membrane protein. Based on available data, E. coli has proven successful as a host for recombinant nuoK expression . Researchers should consider the following methodological approaches:

Expression ParameterOptimal Conditions
Host SystemE. coli
Expression VectorpET or similar with T7 promoter
Fusion TagN-terminal His-tag
InductionIPTG at reduced concentrations (0.1-0.5 mM)
TemperatureLower temperature (16-25°C) post-induction
MediaRich media (LB) or minimal media depending on experimental needs
DurationExtended expression time (16-24 hours) at lower temperatures

For membrane proteins like nuoK, specialized E. coli strains such as C41(DE3) or C43(DE3) designed for membrane protein expression might provide better results by reducing toxicity associated with membrane protein overexpression. Control of expression level is critical to prevent formation of inclusion bodies and ensure proper membrane integration .

What purification strategies ensure maximum yield and activity of nuoK?

Purification of membrane proteins like nuoK requires specialized approaches to maintain structural integrity and function. The following multi-step purification strategy is recommended:

  • Membrane isolation and solubilization:

    • Disrupt cells using sonication or French press

    • Isolate membranes by ultracentrifugation

    • Solubilize membranes using appropriate detergents (DDM, LMNG, or Triton X-100)

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

    • Include detergent in all buffers to maintain solubility

    • Consider using imidazole gradient for elution to minimize contaminants

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography if higher purity is required

The reconstitution buffer should contain Tris/PBS-based buffer with 6% Trehalose at pH 8.0. For storage, add glycerol to a final concentration of 5-50% (with 50% being recommended) and store in aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles .

How can researchers accurately assess the functional integrity of purified nuoK?

Assessing the functional integrity of purified nuoK requires both structural and functional analyses. Since nuoK is part of a larger complex, evaluation often involves either reconstitution approaches or analysis within the context of the entire Complex I:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Size exclusion chromatography to confirm monodispersity

    • Thermal stability assays to assess protein folding

  • Functional reconstitution methods:

    • Incorporation into proteoliposomes or nanodiscs

    • Measurement of proton pumping using pH-sensitive fluorescent dyes

    • Assessment of interaction with other Complex I subunits

  • Enzymatic activity assays (for reconstituted Complex I containing nuoK):

    • NADH oxidation rates measured spectrophotometrically at 340 nm

    • Quinone reduction monitored by absorbance changes

    • Electron transfer rates with various electron acceptors

For intact Complex I containing nuoK, researchers can measure NADH:quinone oxidoreductase activity using different electron acceptors. Similar enzymes show varying kinetic parameters depending on the electron acceptor used, with typical Km values for NADH ranging from 17 to 258 μM .

What are the critical amino acid residues in nuoK that contribute to proton translocation?

Identifying critical residues in nuoK involved in proton translocation requires systematic mutational analysis and functional studies. While specific critical residues of E. coli nuoK are not explicitly identified in the provided search results, researchers should consider the following methodological approach:

  • Sequence conservation analysis:

    • Align nuoK sequences across diverse bacterial species

    • Identify highly conserved residues, particularly charged residues (Arg, Lys, Glu, Asp)

    • Focus on conserved residues within predicted transmembrane domains

  • Site-directed mutagenesis strategy:

    • Target conserved charged residues that might participate in proton transfer

    • Create neutral substitutions (e.g., Asp→Asn, Glu→Gln) to disrupt proton transfer

    • Generate conservative substitutions to assess side chain specificity

  • Functional analysis of mutants:

    • Measure proton pumping efficiency in reconstituted systems

    • Assess NADH oxidation rates to determine coupling efficiency

    • Compare growth phenotypes of mutant strains under various conditions

This systematic approach can reveal residues essential for the proton translocation function of nuoK within Complex I.

How does nuoK interact with other subunits of Complex I?

Understanding the interactions between nuoK and other Complex I subunits requires integrated structural and biochemical approaches:

  • Structural analysis methods:

    • Cross-linking combined with mass spectrometry to identify interacting regions

    • Cryo-electron microscopy of the entire Complex I to visualize subunit interfaces

    • Computational modeling based on available structures of Complex I components

  • Biochemical characterization:

    • Co-purification studies with tagged nuoK to identify stable interacting partners

    • Blue Native PAGE to identify subcomplexes containing nuoK

    • Reconstitution experiments with defined subunit combinations

  • Genetic approach:

    • Second-site suppressor analysis to identify compensatory mutations

    • Bacterial two-hybrid assays to detect protein-protein interactions

    • In vivo cross-linking to capture native interactions

As nuoK is part of the membrane domain of Complex I, it likely interfaces with other membrane subunits involved in proton translocation. Understanding these interactions is crucial for elucidating the complete proton pumping mechanism of Complex I.

What is the relationship between electron transfer and proton translocation in complexes containing nuoK?

The coupling mechanism between electron transfer and proton translocation in Complex I remains one of the central questions in bioenergetics research. To investigate this relationship in systems containing nuoK, researchers should consider:

  • Biophysical analysis approaches:

    • Simultaneous measurement of electron transfer and proton translocation rates

    • Time-resolved studies to detect sequential events in the catalytic cycle

    • Thermodynamic analysis of the coupling efficiency

  • Structure-function correlation:

    • Mutational analysis of residues at the interface between electron transfer and proton translocation domains

    • Investigation of conformational changes using spectroscopic techniques

    • Computational modeling of energy transduction pathways

  • Comparative studies:

    • Analysis of coupling efficiency across different species

    • Correlation of structural features with functional parameters

    • Investigation of uncoupling mechanisms

Current understanding suggests that electron transfer through the redox centers of Complex I induces conformational changes that are transmitted to the membrane domain containing nuoK, driving proton translocation across the membrane .

How can researchers differentiate between the activities of NDH-I (containing nuoK) and NDH-II in E. coli experimental systems?

E. coli possesses two distinct NADH dehydrogenases: NDH-I (Complex I, containing nuoK) and NDH-II. Differentiating their activities requires specific experimental approaches:

  • Genetic discrimination methods:

    • Generate single knockouts (ΔnuoK or Δndh) and double knockouts

    • Complement mutants with wild-type or modified genes

    • Engineer strains with tagged versions of each enzyme for specific detection

  • Biochemical differentiation techniques:

    • NDH-I couples NADH oxidation to proton translocation, while NDH-II does not

    • NDH-II is not inhibited by quinone-site inhibitors of Complex I such as rotenone, piericidin A, capsaicin, and DCCD

    • NADH oxidation by NDH-I contributes to membrane potential (measurable with potential-sensitive dyes)

  • Expression-based differentiation:

    • NDH-II is repressed under anaerobic growth conditions, while NDH-I operates in both aerobic and anaerobic respiration

    • Growth under anaerobic conditions can isolate NDH-I activity

    • The expression of NDH-II is regulated by Fnr, repressing transcription under anaerobic conditions

  • Kinetic parameter comparison:

    • Determine substrate affinities and specificities for each enzyme

    • Measure activities with different electron acceptors to exploit preferential use

These approaches allow researchers to dissect the specific contributions of each NADH dehydrogenase in experimental systems.

What strategies can be employed to study the assembly process of nuoK into Complex I?

Investigating the assembly of nuoK into Complex I requires specialized techniques to track the formation of intermediate complexes:

  • Pulse-chase experimental design:

    • Label newly synthesized proteins with radioactive amino acids

    • Chase with unlabeled amino acids and sample at different time points

    • Immunoprecipitate with antibodies against Complex I or nuoK

    • Analyze the incorporation of labeled nuoK into subcomplexes and mature Complex I

  • Assembly intermediate characterization:

    • Blue Native PAGE to separate native complexes

    • Two-dimensional gel electrophoresis (BN-PAGE followed by SDS-PAGE)

    • Mass spectrometry to identify components of assembly intermediates

    • Time-course analysis to establish assembly sequence

  • Chaperone and assembly factor identification:

    • Co-immunoprecipitation with tagged nuoK

    • Genetic screens for assembly-deficient mutants

    • Proteomic analysis of assembly intermediates to identify non-structural components

  • In vitro reconstitution approach:

    • Purify individual subunits including nuoK

    • Mix in defined combinations to identify minimal functional units

    • Test activity of reconstituted subcomplexes

Understanding the assembly pathway of Complex I provides insights into potential regulation points and the functional significance of assembly intermediates.

What are the most effective methods for studying nuoK in native versus recombinant systems?

Comparing nuoK in native versus recombinant systems requires consideration of different experimental approaches:

AspectNative SystemRecombinant System
Protein SourceIsolation from wild-type E. coliExpression in heterologous host
AdvantagesNative conformation and interactions preservedHigher yield, easier purification, ability to introduce modifications
LimitationsLower yield, complex purificationPotential folding issues, non-native interactions
Key MethodsMembrane isolation, complex purification, activity assaysControlled expression, affinity purification, reconstitution

For effective study in both systems, researchers should:

  • In native systems:

    • Generate antibodies specific to nuoK for detection and immunoprecipitation

    • Use gentle solubilization conditions to preserve native interactions

    • Employ activity-based purification to isolate functional complexes

  • In recombinant systems:

    • Optimize expression conditions to ensure proper folding

    • Consider membrane-mimetic environments for functional studies

    • Validate structural integrity through comparison with native protein characteristics

  • Comparative analyses:

    • Cross-validate findings between both systems

    • Use recombinant system for detailed mechanistic studies

    • Confirm physiological relevance in native system

This integrated approach provides complementary information about nuoK structure and function.

How can nuoK be used as a model for understanding bacterial energy metabolism and adaptation?

nuoK and Complex I serve as excellent models for investigating bacterial energy metabolism and adaptation mechanisms:

  • Metabolic integration analysis:

    • Study how Complex I activity affects central carbon metabolism

    • Investigate the connection between NADH/NAD+ ratio and metabolic flux

    • Explore how insufficient recycling of NADH inhibits tricarboxylic acid cycle enzymes and the glyoxylate shunt

  • Adaptation to environmental conditions:

    • Examine how Complex I activity responds to changes in oxygen availability

    • Investigate the role of Complex I in adaptation to different carbon sources

    • Study the regulation of Complex I in response to stress conditions

  • Energy conservation efficiency studies:

    • Measure the proton pumping efficiency under different conditions

    • Investigate the balance between energy conservation and metabolic flexibility

    • Compare the efficiency of different respiratory chains in various conditions

  • Systems biology approach:

    • Integrate Complex I function into whole-cell metabolic models

    • Study the regulatory networks controlling Complex I expression

    • Investigate metabolic rewiring in response to Complex I dysfunction

Understanding nuoK and Complex I provides insights into fundamental aspects of bacterial energy metabolism and adaptation strategies.

What insights can comparative studies of nuoK across different bacterial species provide?

Comparative analysis of nuoK across bacterial species can reveal evolutionary patterns and functional adaptations:

  • Sequence-function relationship exploration:

    • Identify conserved regions essential for function

    • Detect lineage-specific adaptations that might reflect environmental niches

    • Correlate sequence variations with differences in proton pumping efficiency

  • Structural comparison approach:

    • Compare transmembrane topology across species

    • Identify structural features that correlate with functional differences

    • Examine co-evolution patterns with interacting subunits

  • Functional comparative analysis:

    • Compare substrate specificities and kinetic parameters

    • Investigate differences in regulation and expression

    • Examine coupling efficiency variations across species

  • Evolutionary context examination:

    • Reconstruct the evolutionary history of Complex I

    • Identify horizontal gene transfer events

    • Study the co-evolution of nuoK with other Complex I subunits

These comparative approaches can reveal how different bacterial species have optimized their energy conservation mechanisms for specific ecological niches.

How might understanding nuoK contribute to biotechnological applications?

Knowledge of nuoK and Complex I can be leveraged for various biotechnological applications:

  • Metabolic engineering applications:

    • Modulate NADH/NAD+ balance in production strains

    • Engineer more efficient respiratory chains for industrial microorganisms

    • Prevent overflow metabolism in applications requiring cells with high energy demand

  • Bioenergy development:

    • Design improved electron transfer systems for microbial fuel cells

    • Enhance energy conservation in biofuel-producing organisms

    • Engineer artificial electron transport chains with optimized efficiency

  • Antimicrobial target exploration:

    • Develop compounds targeting bacterial Complex I

    • Design species-specific inhibitors based on structural differences

    • Create screening platforms for respiratory chain inhibitors

  • Biosensor development:

    • Create NADH/NAD+ ratio sensors based on Complex I components

    • Develop whole-cell biosensors for electron transport chain inhibitors

    • Design reporters for redox status in bacterial cells

Understanding the structure-function relationship of nuoK within Complex I provides a foundation for rational design approaches in these biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.