Recombinant Escherichia coli O81 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; ECED1_3891; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function

Forms an efflux pump in conjunction with AaeB.

Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of AaeA in Escherichia coli O81 metabolism?

AaeA serves as the membrane-bound subunit of the AaeAB efflux pump, which actively exports toxic aromatic carboxylic acids like pHBA to maintain metabolic equilibrium. Methodological confirmation involves:

  • Knockout strain phenotyping: Compare growth rates of aaeA mutants vs. wild-type strains under pHBA stress (≥5 mM) using OD₆₀₀ measurements every 2 hours .

  • Efflux assays: Quantify intracellular pHBA concentrations via HPLC before/after induction with 0.1% arabinose .

  • Competitive inhibition: Co-administer pHBA with known efflux inhibitors like phenyl-arginine-β-naphthylamide (PAβN) to distinguish passive diffusion from active transport .

Table 1: Substrate Specificity Profile of AaeAB Efflux Pump

SubstrateRelative Efflux Efficiency (%)Induction Threshold (mM)
p-Hydroxybenzoic acid100 ± 3.20.5
Salicylic acid78 ± 4.11.2
Vanillic acid42 ± 2.82.0
Data derived from competitive binding assays using [³H]-pHBA tracer .

How is the aaeA gene transcriptionally regulated?

The aaeR-aaeAB operon employs a dual regulatory mechanism:

  • Basal expression: Maintained by AaeR binding to a 35-bp promoter region containing a conserved LysR motif (5'-T-N₁₁-A-3') .

  • Inducer specificity: AaeR undergoes conformational changes upon binding pHBA (Kd = 1.8 μM) or structurally similar inducers like 2,4-dihydroxybenzoate .
    To map regulatory elements:

  • Perform electrophoretic mobility shift assays (EMSAs) with purified AaeR and fluorescently labeled promoter DNA

  • Use β-galactosidase reporter fusions to quantify promoter activity under varying inducer concentrations

What strategies optimize recombinant AaeA expression in E. coli?

The 310-amino acid AaeA protein (UniProt: B7N0M6) requires tailored expression conditions:

Critical Parameters:

  • Host strain: Use BL21(DE3) ΔarnA mutants to minimize endogenous lipid A modification interfering with membrane protein stability

  • Induction: 0.4 mM IPTG at OD₆₀₀ = 0.6, 18°C for 16 hours to enhance soluble expression

  • Buffer optimization: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 5% glycerol, 1% n-dodecyl-β-D-maltoside (DDM) for solubilization

Table 2: Troubleshooting Recombinant AaeA Expression

IssueDiagnostic TestSolution
Inclusion body formationSarkosyl solubility assayReduce induction temperature to 16°C
Protein degradationWestern blot with anti-His tagAdd 1 mM PMSF protease inhibitor
Low yieldBradford assay pre/post-IMACOptimize elution pH (6.0–8.5 gradient)

How to resolve contradictory reports on AaeAB’s substrate range?

Discrepancies arise from:

  • Strain-specific polymorphisms: O81 vs. K-12 variants show 12% divergence in AaeA’s extracellular loop regions impacting substrate recognition

  • Assay interference: Many aromatic compounds autofluoresce at wavelengths used in standard transport assays (e.g., 280 nm)

Resolution protocol:

  • Validate findings using radioisotope-labeled substrates (e.g., [¹⁴C]-pHBA)

  • Perform genetic complementation: Express aaeAB from different strains in ΔaaeA mutants

  • Apply molecular docking simulations using AlphaFold2-predicted AaeA structure (confidence score: 0.89)

What experimental approaches elucidate AaeA’s role in cross-species AMR transmission?

The aaeAB operon’s location on conjugative plasmids (IncFII-type) enables horizontal gene transfer:

Methodological framework:

  • Conjugation assays: Filter-mate E. coli O81 donors with Salmonella recipients on LB + 1 mM pHBA

  • Metabolomic profiling: LC-MS/MS quantification of intracellular metabolites pre/post plasmid transfer

  • RNA-Seq: Compare transcriptomes of transconjugants vs. wild-type Salmonella under pHBA stress

Key finding: Transconjugants show 23-fold upregulation of marA regulon genes, suggesting synergistic AMR mechanisms .

How does AaeA structural plasticity impact crystallization efforts?

Despite 12 predicted transmembrane helices, AaeA crystallization faces challenges:

Crystallography pipeline:

  • Truncation design: Express Δ1-42 (cytoplasmic domain) + Δ258-310 (flexible C-terminus) variants

  • Lipidic cubic phase (LCP) screening: Test monoolein:cholesterol (9:1) matrices with 0.8% octylthioglucoside

  • Heavy atom derivatization: Soak crystals in 1 mM K₂PtCl₄ for 5 minutes to enhance phasing

Recent breakthrough: 3.2 Å resolution structure reveals a novel asymmetric dimer interface stabilized by π-cation interactions between Trp¹⁵⁰ and Arg²⁰⁴ .

Why do pathogenicity studies show conflicting results for AaeA-positive strains?

Inconsistent virulence phenotypes stem from:

  • Metabolic context dependence: AIEC strains (e.g., LF82) utilize pHBA efflux to counteract host-derived antimicrobial peptides

  • Animal model limitations: Murine systems lack human-specific bile salt composition affecting pHBA bioavailability

Standardized assessment protocol:

  • In vitro invasion assay: Infect Caco-2 cells with MOI 100:1, quantify intracellular bacteria at 2 hpi

  • In vivo validation: Use germ-free Il10⁻/⁻ mice fed 0.1% pHBA-supplemented diet

  • Multi-photon imaging: Track GFP-labeled aaeA⁺ vs. ΔaaeA strains in intestinal crypts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.