Recombinant Escherichia coli O81 Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Membrane Biogenesis

MdoB catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs), forming phosphoglycerol diesters. Key findings include:

  • In vitro activity: Transfers phosphoglycerol to arbutin or MDOs, producing sn-1,2-diglyceride as a byproduct .

  • Genetic evidence: mdoB mutants lack phosphoglycerol in MDOs and exhibit resistance to arbutin-induced growth inhibition .

  • Membrane localization: Active site located on the outer face of the inner cytoplasmic membrane, enabling extracellular substrate modification .

Expression Systems

  • Host strains: Engineered E. coli BL21(DE3) derivatives (e.g., Origami™, SHuffle®) with oxidative cytoplasm enhance disulfide bond formation for soluble expression .

  • Induction: IPTG-driven T7 RNA polymerase system, with optimized induction at OD<sub>600</sub> 0.6–0.8 and low-temperature (20°C) post-induction incubation .

Challenges and Solutions

  • Toxicity mitigation: Weak lacUV5 promoter variants in strains like C41(DE3) reduce T7 RNA polymerase activity, improving viability during membrane protein expression .

  • Secretion: SRP (signal recognition particle)-dependent pathways using DsbA signal peptides enable periplasmic localization, reducing cytoplasmic aggregation .

Applications in Biotechnology

  • Enzyme immobilization: Calcium alginate-activated carbon matrices enhance catalytic stability, achieving 1.8-fold higher reaction rates for substrate conversion .

  • Cofactor regeneration: Co-expression with BsGDH (glucose dehydrogenase) enables NADPH recycling, critical for redox reactions in biocatalysis .

Research Findings and Innovations

  • Structural insights: Conserved DH motif (residues D<sub>435</sub> and H<sub>436</sub>) and histidine residue (H<sub>379</sub>) are essential for phosphoglycerol transfer activity .

  • Industrial relevance: High-yield production (195 mM product) achieved using fed-batch strategies with immobilized recombinant cells .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; ECED1_5227; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLAAVFGALGWILRRRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSRTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIATFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKAIWKGKTAFKD TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Phosphoglycerol Transferase I (mdoB) and what is its fundamental role in Escherichia coli?

Phosphoglycerol Transferase I, encoded by the mdoB gene (also known as opgB), is an enzyme localized in the inner cytoplasmic membrane of Escherichia coli. It catalyzes the transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDOs) . This enzyme plays a critical role in the membrane biology of E. coli, particularly in the modification of periplasmic glucans. The enzymatic activity is classified under EC 2.7.8.20 (phosphatidylglycerol-membrane-oligosaccharide glycerophosphotransferase) . The full-length protein consists of 763 amino acid residues and functions primarily in the phosphoglycerolation of bacterial oligosaccharides, which affects membrane permeability and bacterial adaptation to osmotic stress .

How does the structure of Phosphoglycerol Transferase I relate to its function?

Phosphoglycerol Transferase I is a membrane-bound protein with specific structural domains that facilitate its function. The protein contains transmembrane segments that anchor it to the cytoplasmic membrane, allowing it to interact with both membrane phospholipids and oligosaccharide substrates . The enzyme's active site is positioned to facilitate the transfer of phosphoglycerol groups from the membrane-embedded phosphatidylglycerol to MDO molecules. This positioning is critical for its catalytic activity. The full amino acid sequence (1-763) contains hydrophobic regions consistent with membrane association, as well as charged residues likely involved in substrate recognition and catalysis . This structural arrangement allows the enzyme to efficiently transfer phosphoglycerol residues from phosphatidylglycerol to the MDO substrate in the periplasmic space.

What are the differences between Phosphoglycerol Transferase I and Phosphoglycerol Transferase II?

While both enzymes are involved in phosphoglycerol metabolism, they serve distinct functions:

CharacteristicPhosphoglycerol Transferase I (mdoB)Phosphoglycerol Transferase II
LocalizationInner cytoplasmic membranePeriplasmic, soluble
SubstratePhosphatidylglycerol as donorDoes not use phosphatidylglycerol
FunctionPrimary transfer of phosphoglycerol from phosphatidylglycerol to MDOCatalyzes interchange of phosphoglycerol residues among soluble MDO species
GenemdoB (opgB)Different genetic locus
Effect of mdoB mutationBlocks utilization of phosphatidylglycerolNot affected by mdoB mutation

As demonstrated in the research, strains with mdoB mutations maintain active Phosphoglycerol Transferase II but still produce MDO lacking phosphoglycerol residues, confirming that Phosphoglycerol Transferase I is specifically responsible for the primary transfer from phosphatidylglycerol .

How can recombinant Phosphoglycerol Transferase I be utilized in membrane biology studies?

Recombinant Phosphoglycerol Transferase I serves as a valuable tool in researching bacterial membrane biology. The purified recombinant protein, particularly His-tagged versions, allows researchers to investigate the mechanisms of phosphoglycerol transfer in controlled in vitro systems . These studies can reveal insights into membrane lipid dynamics and the modification of periplasmic glucans.

For advanced applications, researchers can:

  • Employ the recombinant enzyme in reconstituted membrane systems to study phospholipid-protein interactions

  • Utilize enzyme kinetics to investigate the transfer mechanism under varying conditions

  • Develop assays to screen for inhibitors of phosphoglycerol transfer as potential antimicrobial agents

  • Study the enzyme's role in bacterial adaptation to environmental stresses through controlled expression systems

The His-tagged recombinant version provides additional advantages for protein purification, immobilization on surfaces for interaction studies, and development of high-throughput screening platforms .

What are the implications of mdoB mutations on bacterial membrane physiology?

Genetic studies have demonstrated that mdoB mutations have significant implications for bacterial membrane physiology. Mutants defective in Phosphoglycerol Transferase I produce MDOs that are completely devoid of phosphoglycerol residues . This alteration in MDO composition affects multiple aspects of bacterial physiology:

  • Osmotic regulation: MDOs play a role in adaptation to osmotic stress, and the absence of phosphoglycerol modifications may alter this response

  • Membrane permeability: Changes in MDO structure can affect the permeability properties of the bacterial cell envelope

  • Antibiotic susceptibility: Modified membrane properties may influence the entry of certain antibiotics

  • Cell-surface interactions: Altered surface characteristics may affect bacterial adhesion and biofilm formation

Experimental evidence from genetic studies shows that both mdoB::TnJO mutations and spontaneous mdoB1 alleles result in MDOs with dramatically reduced phosphoglycerol content (0.05-0.06 mol of phosphoglycerol per mol of MDO compared to 2.0 in wild-type strains) . This finding confirms the essential role of Phosphoglycerol Transferase I in MDO modification in vivo.

What are the optimal conditions for expressing and purifying recombinant Phosphoglycerol Transferase I?

Optimal expression and purification of recombinant Phosphoglycerol Transferase I requires specific conditions to maintain protein stability and activity:

Expression System:

  • E. coli is the preferred expression host for full-length mdoB protein

  • Expression constructs typically include N-terminal His-tags for purification

  • The full-length protein (1-763 amino acids) can be successfully expressed in E. coli systems

Purification Protocol:

  • Lyse cells in buffer containing protease inhibitors

  • Purify using nickel affinity chromatography for His-tagged proteins

  • Perform additional purification steps if needed (ion exchange, size exclusion)

  • Concentrate to desired concentration and store appropriately

Storage Conditions:

  • Store at -20°C/-80°C for long-term stability

  • Avoid repeated freeze-thaw cycles

  • For working stocks, maintain aliquots at 4°C for up to one week

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 for optimal stability

Reconstitution:

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

  • Centrifuge vials briefly before opening to bring contents to the bottom

How can Phosphoglycerol Transferase I activity be measured in laboratory settings?

Several established methodologies exist for measuring Phosphoglycerol Transferase I activity:

In Vitro Enzymatic Assay:

  • Prepare membrane fractions from bacteria expressing Phosphoglycerol Transferase I

  • Utilize radioisotope-labeled phosphatidylglycerol as the phosphoglycerol donor

  • Measure transfer to appropriate acceptor substrates (MDOs or model substrates like arbutin)

  • Quantify product formation via scintillation counting or chromatographic methods

Alternative Substrates:
Research has shown that model substrates with β-glucoside structures similar to MDO but with hydrophobic, aromatic aglycones (particularly arbutin) are effectively utilized by the enzyme and can simplify activity measurements .

Activity Quantification:
Typical enzyme activity is expressed in nmol/h per mg of protein. Wild-type E. coli strains show approximately 6.0 nmol/h per mg of protein, while mdoB mutants show undetectable activity (<0.05-0.09 nmol/h per mg) .

What experimental approaches can be used to investigate the specificity of Phosphoglycerol Transferase I for different substrates?

Investigating substrate specificity requires multiple experimental approaches:

Competitive Inhibition Assays:

  • Utilize a standard activity assay with labeled donor and acceptor

  • Add potential substrate analogs as competitors

  • Measure the degree of inhibition to assess relative binding affinity

  • Calculate inhibition constants to quantify specificity

Site-Directed Mutagenesis:

  • Identify potential substrate-binding residues through sequence analysis or structural modeling

  • Create point mutations in these residues

  • Express and purify the mutant proteins

  • Assess activity changes with different substrates to map specificity determinants

Structure-Activity Relationship Studies:
Systematic testing of related compounds can reveal structural features required for substrate recognition. Research has shown that while MDO is poorly utilized in vitro at physiological concentrations, model substrates with β-glucoside structures and hydrophobic aglycones are effectively used by the enzyme .

How does Phosphoglycerol Transferase I contribute to the bacterial cell envelope biogenesis?

Phosphoglycerol Transferase I plays a crucial role in bacterial cell envelope biogenesis through its specific function in MDO modification:

  • Membrane-Derived Oligosaccharide Modification: The enzyme transfers phosphoglycerol groups from phosphatidylglycerol to MDOs, creating phosphoglycerol-modified periplasmic glucans .

  • Periplasmic Space Architecture: Modified MDOs contribute to the structural and functional properties of the periplasmic space, affecting cell envelope integrity.

  • Osmotic Regulation: Phosphoglycerol-modified MDOs are involved in bacterial adaptation to changes in osmotic pressure, which is essential for maintaining cell viability under varying environmental conditions.

  • Membrane Lipid Homeostasis: The transfer process also affects phospholipid turnover, potentially contributing to membrane lipid homeostasis.

The proposed physiological pathway involves:

  • Initial transfer of phosphoglycerol from phosphatidylglycerol to carrier-bound MDO by Phosphoglycerol Transferase I in the cytoplasmic membrane

  • Subsequent transfer of these modified MDOs to soluble forms in the periplasm

  • Further modification by Phosphoglycerol Transferase II, which redistributes phosphoglycerol groups among soluble MDO species

What genetic approaches are most effective for studying mdoB function?

Several genetic approaches have proven effective for studying mdoB function:

Transposon Mutagenesis:
The mdoB::TnJO mutation has been successfully used to create defined insertional mutations in the mdoB gene. This approach allows precise disruption of gene function while providing a selectable marker for tracking the mutation .

Spontaneous Mutation Selection:
Spontaneous mdoB mutants can be isolated by selecting for arbutin resistance in appropriate genetic backgrounds (e.g., strain RZ60 dgk-6). This method has proven powerful enough that prior treatment with transposons or other mutagens is not necessary .

Genetic Mapping Through P1 Transduction:
Three-factor crosses via P1 transduction have been used to map the mdoB gene location. Using appropriate donor and recipient strains, the gene order has been established as mdoB serB thr in the clockwise direction on the E. coli chromosome .

Complementation Analysis:
Introducing wild-type mdoB gene on plasmids into mutant strains can confirm the specific role of the gene product in phosphoglycerol transfer and MDO modification.

What is the relationship between Phosphoglycerol Transferase I activity and MDO phosphoglycerol content?

Research has established a direct relationship between Phosphoglycerol Transferase I activity and MDO phosphoglycerol content:

StrainPhosphoglycerol transferase I activity (nmol/h per mg of protein)mol of P-GRO per mol of MDO
AB1133 mdoB+6.02.0
NFB114 mdoBl<0.050.06
PT227 mdoB::TnJO<0.090.05

As shown in this data from experimental studies, there is a strong correlation between enzyme activity and MDO phosphoglycerol content . Wild-type strains (mdoB+) show normal enzyme activity and contain approximately 2 phosphoglycerol residues per MDO molecule. In contrast, both spontaneous (mdoB1) and transposon-insertion (mdoB::TnJO) mutants show undetectable enzyme activity and dramatically reduced phosphoglycerol content in their MDOs.

This direct relationship confirms that Phosphoglycerol Transferase I is indeed the enzyme responsible for transferring phosphoglycerol groups from phosphatidylglycerol to MDO in living cells, as had been proposed based on in vitro studies .

What are common challenges in working with recombinant Phosphoglycerol Transferase I and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant Phosphoglycerol Transferase I:

Protein Stability Issues:

  • Challenge: As a membrane protein, Phosphoglycerol Transferase I can show stability issues during purification and storage.

  • Solution: Add stabilizing agents such as trehalose (6%) to storage buffers and maintain at appropriate pH (8.0). Avoid repeated freeze-thaw cycles by preparing single-use aliquots .

Low Activity in Reconstitution Experiments:

  • Challenge: Recombinant enzyme may show reduced activity after purification.

  • Solution: Ensure proper folding by optimizing reconstitution conditions. Consider including phospholipids or detergents at concentrations that maintain protein structure without inhibiting activity.

Substrate Accessibility:

  • Challenge: The natural MDO substrates are poorly utilized in vitro.

  • Solution: Use model substrates like arbutin that contain the β-glucoside structure with hydrophobic aglycones, which are more effectively utilized by the enzyme in vitro .

Expression of Full-Length Protein:

  • Challenge: The full-length protein (763 amino acids) may be difficult to express in certain systems.

  • Solution: Optimize codon usage for expression host, use appropriate promoters, and consider expression at lower temperatures to improve folding .

How can conflicting data regarding Phosphoglycerol Transferase I function be reconciled?

When facing conflicting data regarding Phosphoglycerol Transferase I function, researchers should consider several factors:

In Vitro vs. In Vivo Discrepancies:
Phosphoglycerol Transferase I catalyzes transfer to soluble MDO forms poorly in vitro and only at high concentrations, yet is clearly involved in MDO modification in vivo . This discrepancy can be reconciled by considering that:

  • The true physiological substrate may be a carrier-bound form of MDO, not the soluble forms typically used in vitro

  • Additional cellular factors may be required for optimal activity that are missing in purified systems

Substrate Specificity Differences:
The enzyme effectively utilizes model substrates with β-glucoside structures and hydrophobic aglycones, while showing poor activity with soluble MDO forms. This suggests that:

  • The hydrophobic environment of the membrane may be important for substrate positioning

  • The natural substrate may present its glucoside moieties in a specific orientation that is better mimicked by model substrates

Genetic vs. Biochemical Evidence:
Genetic studies unequivocally demonstrate that mdoB mutations eliminate phosphoglycerol residues from MDO, while Phosphoglycerol Transferase II activity remains normal . This confirms that:

  • Phosphoglycerol Transferase I is specifically responsible for the primary transfer from phosphatidylglycerol to MDO

  • Phosphoglycerol Transferase II only redistributes phosphoglycerol residues among existing MDO molecules

What analytical techniques are most informative for characterizing MDO phosphoglycerol content?

Several analytical techniques provide valuable information about MDO phosphoglycerol content:

Hydrofluoric Acid Treatment:

  • Treat purified MDO with HF to liberate glycerol from phosphoglycerol

  • Measure released glycerol colorimetrically

  • Calculate mol of phosphoglycerol per mol of MDO based on glucose content
    This method has successfully demonstrated differences between wild-type (2.0 mol P-GRO per mol MDO) and mdoB mutant strains (0.05-0.06 mol P-GRO per mol MDO) .

Radiolabeling Approaches:

  • Label MDO with isotopes such as [2-³H]glycerol

  • Purify labeled MDO using chromatographic methods

  • Measure incorporation of label to quantify modification

Chromatographic Analysis:

  • Purify MDO by appropriate chromatographic methods

  • Determine glucose content colorimetrically

  • Analyze phosphoglycerol content through specific assays

  • Calculate the ratio of phosphoglycerol to glucose to determine degree of modification

Mass Spectrometry:
For detailed structural analysis, mass spectrometry can provide precise information about MDO composition and modifications, allowing identification of various substituted forms.

What emerging technologies might advance our understanding of Phosphoglycerol Transferase I function?

Several emerging technologies hold promise for deepening our understanding of Phosphoglycerol Transferase I:

Cryo-Electron Microscopy:
Advances in cryo-EM could enable determination of the three-dimensional structure of Phosphoglycerol Transferase I in its native membrane environment, providing insights into the mechanism of phosphoglycerol transfer and substrate recognition.

In-Cell NMR Spectroscopy:
This technology could allow observation of enzyme-substrate interactions within living cells, bridging the gap between in vitro and in vivo studies of Phosphoglycerol Transferase I function.

Single-Molecule Enzymology:
Applying single-molecule techniques could reveal the dynamics of phosphoglycerol transfer reactions and potentially identify transient intermediates in the catalytic cycle.

CRISPR-Based Genome Editing:
More precise genetic manipulation using CRISPR technology could facilitate creation of specific mutations to probe structure-function relationships in Phosphoglycerol Transferase I with unprecedented precision.

Synthetic Biology Approaches:
Engineering artificial membrane systems with defined compositions could help elucidate the importance of the lipid environment for Phosphoglycerol Transferase I function and potentially enable applications in biotechnology.

How might research on Phosphoglycerol Transferase I contribute to antimicrobial development?

Research on Phosphoglycerol Transferase I holds potential for antimicrobial development through several mechanisms:

Novel Target Identification:
As an enzyme involved in bacterial envelope biogenesis, Phosphoglycerol Transferase I represents a potential target for new antimicrobial agents. The absence of homologous enzymes in humans makes it an attractive candidate for selective inhibition .

Combination Therapy Approaches:
Understanding how MDO modification affects bacterial physiology could reveal synergies with existing antibiotics. Inhibiting Phosphoglycerol Transferase I might sensitize bacteria to antibiotics that target cell envelope integrity.

Biofilm Disruption:
If phosphoglycerol-modified MDOs play roles in biofilm formation or maintenance, targeting Phosphoglycerol Transferase I could provide strategies to disrupt biofilms, which are often resistant to conventional antimicrobials.

Virulence Modulation:
Alterations in cell envelope components can affect bacterial virulence. Targeting Phosphoglycerol Transferase I might reduce pathogenicity without necessarily killing bacteria, potentially reducing selective pressure for resistance development.

Screening Platforms:
Recombinant Phosphoglycerol Transferase I can be used to develop high-throughput screening platforms to identify inhibitors from chemical libraries, natural products, or rationally designed compounds .

What controls are essential when performing experiments with recombinant Phosphoglycerol Transferase I?

Robust experimental design with appropriate controls is essential for research involving recombinant Phosphoglycerol Transferase I:

Enzymatic Activity Controls:

  • Positive control: Include wild-type enzyme preparations with known activity levels (approximately 6.0 nmol/h per mg protein)

  • Negative control: Use heat-inactivated enzyme or preparations from mdoB mutant strains that show undetectable activity (<0.05-0.09 nmol/h per mg protein)

  • Substrate specificity control: Compare activity with model substrates (arbutin) versus natural MDO substrates

Protein Quality Controls:

  • Purity verification: Confirm enzyme preparation purity via SDS-PAGE (should be greater than 90%)

  • Activity preservation: Verify stability under storage conditions through regular activity testing

  • Functional verification: Use site-directed mutagenesis of catalytic residues to create inactive variants for comparison

Expression System Controls:

  • Empty vector control: Express and purify protein from host cells transformed with empty expression vector

  • Alternate tag control: Express protein with different purification tags to assess tag influence on activity

  • Host strain verification: Express protein in multiple bacterial strains to evaluate host effects

Experimental Design Controls:

  • Time course measurements: Ensure reactions are measured in the linear range of enzyme activity

  • Substrate concentration variations: Perform kinetic analysis to determine optimal substrate concentrations

  • Buffer component controls: Systematically vary buffer components to identify optimal reaction conditions

How can researchers integrate genetic and biochemical approaches to study Phosphoglycerol Transferase I?

A comprehensive understanding of Phosphoglycerol Transferase I requires integration of genetic and biochemical approaches:

Complementary Experimental Strategy:

  • Generate defined genetic mutations in mdoB (transposon insertions, point mutations, deletions)

  • Characterize mutant phenotypes in vivo (MDO composition, membrane properties)

  • Express and purify corresponding mutant proteins for in vitro activity analysis

  • Correlate in vitro enzymatic properties with in vivo phenotypes

Structure-Function Analysis:

  • Use site-directed mutagenesis to create specific amino acid substitutions

  • Evaluate effects on enzyme activity in vitro and MDO modification in vivo

  • Map functional domains through systematic mutagenesis and activity testing

Suppressor Analysis:

  • Identify suppressor mutations that restore function to mdoB mutants

  • Characterize these suppressors genetically and biochemically

  • Use findings to identify interacting proteins or pathways

In Vivo Activity Measurement:

  • Develop assays to monitor phosphoglycerol transfer in intact cells

  • Compare with in vitro measurements using purified components

  • Identify cellular factors that may influence enzyme activity

This integrated approach has successfully demonstrated that Phosphoglycerol Transferase I is indeed responsible for transferring phosphoglycerol residues to MDO in vivo, despite the enzyme's poor activity with soluble MDO forms in vitro .

What are the most significant recent advances in understanding Phosphoglycerol Transferase I function?

Recent advances in understanding Phosphoglycerol Transferase I function have significantly expanded our knowledge of this important enzyme:

  • Genetic-Biochemical Correlation: Studies have firmly established the direct relationship between Phosphoglycerol Transferase I activity and MDO phosphoglycerol content, confirming the enzyme's physiological role in transferring phosphoglycerol residues from phosphatidylglycerol to MDO in vivo .

  • Substrate Specificity Insights: Research has clarified that while the enzyme poorly utilizes soluble MDO forms in vitro, it effectively transfers phosphoglycerol to model substrates with β-glucoside structures and hydrophobic aglycones, suggesting that the natural substrate may be a carrier-bound form of MDO .

  • Functional Differentiation: Clear differentiation between the roles of Phosphoglycerol Transferase I and II has been established, with Phosphoglycerol Transferase I performing the primary transfer from phosphatidylglycerol and Phosphoglycerol Transferase II redistributing phosphoglycerol residues among soluble MDO species .

  • Recombinant Protein Production: Development of expression and purification protocols for recombinant His-tagged Phosphoglycerol Transferase I has facilitated more detailed biochemical studies of this important enzyme .

  • Genetic Mapping: Precise genetic mapping has located the mdoB gene in relation to other genetic markers (serB and thr) on the E. coli chromosome, enhancing our understanding of its genomic context .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.