Recombinant Escherichia coli O81 Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Introduction

The high-affinity potassium uptake system in bacteria and archaea is facilitated by the ATP-driven KdpFABC complex . This complex is classified as a type IA P-type ATPase, based on the biochemical properties of its ATP-hydrolyzing subunit, KdpB . The KdpA subunit is responsible for K+ transport and bears a resemblance to a potassium channel, making the KdpFABC complex a combination of ion pumps and ion channels .

Recombinant Production

Recombinant protein expression in Escherichia coli is a widely used technique for producing proteins of interest . Various approaches exist for the synthesis of recombinant proteins in E. coli, and the field is continuously advancing . The production of recombinant E. coli O81 Potassium-transporting ATPase C chain (kdpC) is achieved using an in vitro E. coli expression system .

Plasmid Copy Number Quantification

Real-time quantitative PCR (QPCR) methods are employed to determine plasmid copy number in recombinant Escherichia coli cultures . Absolute and relative quantification methods are compatible and have been tested with recombinant E. coli DH5α harboring pBR322, a common bacterial cloning vector . The plasmid and the host chromosomal DNA are separately detected using two primer sets specific for the plasmid β-lactamase gene (bla) and the chromosomal d-1-deoxyxylulose 5-phosphate synthase gene (dxs), respectively . The plasmid copy number can be determined as the copy ratio of bla to dxs, since both are single-copy genes of pBR322 and E. coli chromosomal DNA, respectively .

GeneAmplicon Size (bp)Melting Temperature (°C)
bla8187.0
dxs11386.5

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
kdpC; ECED1_0675; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
kdpC
Target Protein Sequence
MSGLRPALSTFLFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAALRAANPNASTNVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE
Uniprot No.

Target Background

Function
The Escherichia coli O81 Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by forming a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the KdpFABC complex and what role does KdpC play within it?

The KdpFABC complex is a high-affinity ATP-driven K+ transport system in prokaryotes that maintains ionic homeostasis under stress conditions. It comprises four membrane-bound subunits: KdpF, KdpA, KdpB, and KdpC. While KdpB functions as the catalytical subunit, KdpA serves as the K+-translocating subunit, and KdpF acts as a stabilizing peptide, the specific function of KdpC remains incompletely characterized . Structural studies have shown that KdpC has a unique periplasmic domain anchored by a single transmembrane helix, and its location at the entrance to the selectivity filter suggests it might act as a periplasmic filter or gate, though evidence for this role is currently limited . The complex combines features of both channel-like components (KdpA) from the superfamily of K+ transporters and pump-like elements (KdpB) from the superfamily of P-type ATPases .

What expression systems are most effective for recombinant KdpC production?

E. coli-based expression systems remain the gold standard for recombinant KdpC production due to their rapid growth rates, high-density culture capabilities, and efficient foreign DNA transfection . For optimal expression of recombinant KdpC, vector selection is crucial, with pET series vectors containing the pMB1 initiator (maintaining 15-60 copies per bacterial cell) being particularly effective . When expressing membrane proteins like KdpC, low-temperature induction (around 11°C) is recommended as it slows protein synthesis, potentially improving proper folding and reducing inclusion body formation . Considerations should include:

ParameterRecommended ConditionRationale
Expression Temperature11-16°CReduces inclusion body formation
MediaLB with supplementsSupports membrane protein expression
InductionGradual (low IPTG)Prevents toxicity and misfolding
Cell Density at InductionOD600 0.6-0.8Optimal metabolic state

For structural studies, it's worth noting that the KdpFABC complex has been successfully expressed using the endogenous promoter that responds to K+ deficiency in media, followed by purification via Ni-NTA affinity chromatography and size-exclusion chromatography .

What purification strategies yield the highest purity and activity for recombinant KdpC?

Purification of recombinant KdpC or the entire KdpFABC complex requires careful consideration of membrane protein characteristics. High-quality preparations with >85% purity (as assessed by SDS-PAGE) can be achieved through a multi-step process . For the KdpFABC complex, an effective purification protocol involves:

  • Initial extraction with appropriate detergents (n-decyl-β-maltoside at 0.15% has been successfully used)

  • Ni-NTA affinity chromatography utilizing His-tags

  • Size-exclusion chromatography in buffer containing:

    • 25 mM Tris pH 7.5

    • 10% glycerol

    • 1 mM TCEP

    • 100 mM NaCl

    • 0.15% n-decyl-β-maltoside

For optimal protein stability, reconstitution recommendations include deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C . Activity assessment can be performed using coupled enzyme assays for ATPase activity and electrogenic K+ transport monitoring in reconstituted proteoliposomes using either voltage-sensitive dyes like DisC3 or by capacitative coupling .

How does the structure of KdpC contribute to the function of the KdpFABC complex?

Recent structural studies using cryo-electron microscopy (cryo-EM) have provided important insights into KdpC's potential role. KdpC possesses a unique periplasmic domain anchored by a single transmembrane helix positioned at the entrance to the selectivity filter of KdpA . While KdpB undergoes significant conformational changes during the transport cycle, KdpC maintains a relatively static structure, with pairwise alignment of KdpC producing root mean square deviation (RMSD) values below 0.5 Å for C-α atoms across different enzymatic states .

This structural stability suggests that KdpC may serve as a stabilizing element for the complex rather than directly participating in the conformational changes associated with ion transport. Its location at the entrance to the selectivity filter suggests a potential role in regulating ion access or serving as a periplasmic gate, though definitive evidence for this function is still emerging . Importantly, while the exact mechanistic role remains unclear, deletion studies confirm that KdpC is essential for the proper functioning of the KdpFABC complex .

What are the critical domains or residues in KdpC required for function?

Truncation experiments with the kdpC gene have revealed that the C-terminal region plays an important role in function. Specifically, only one derivative lacking the base pairs coding for the four C-terminal amino acids was able to complement a chromosomal deletion of kdpC . This suggests that while the extreme C-terminus may be dispensable, the majority of the protein is required for proper function.

Domain swapping experiments between KdpC proteins from different species have provided additional insights. When creating hybrids between kdpC of E. coli and C. acetobutylicum, researchers found that either the N-terminal transmembrane segment or the C-terminal third of the protein could be exchanged between species, but not simultaneously . This indicates that there are critical interactions between these regions that must be maintained for proper folding and function.

DomainFunctional SignificanceEvidence
N-terminal transmembrane segmentCan be exchanged with homologous regions from select speciesComplementation studies with hybrids
C-terminal regionFinal four amino acids dispensable; remainder criticalTruncation complementation experiments
Central domainEssential for proper folding and functionCannot be exchanged simultaneously with other domains

How does KdpC interact with other subunits in the KdpFABC complex during the transport cycle?

Recent cryo-EM studies have elucidated the complex interactions between KdpC and other subunits during the transport cycle. Unlike KdpB, which undergoes significant conformational changes consistent with other P-type ATPases, KdpC (along with KdpA and KdpF) remains relatively static throughout the reaction cycle . This suggests that KdpC primarily serves a structural role rather than directly participating in the conformational changes associated with ion transport.

What methodologies are most effective for studying KdpC's role in the potassium transport mechanism?

Advanced research into KdpC's function benefits from a multi-faceted approach combining structural, functional, and genetic techniques:

  • Structural studies using cryo-EM:

    • Using substrate analogs to stabilize different enzymatic states has proven effective in capturing the complex in discrete conformational states

    • Comparative analysis of structures in the presence of either K+ or Na+ can reveal ion-specific interactions

  • Functional assessment through reconstitution:

    • Electrogenic K+ transport in proteoliposomes can be monitored using voltage-sensitive dyes like DisC3

    • Capacitative coupling using specialized equipment (SURFE2N1) provides detailed transport kinetics

  • Genetic manipulation approaches:

    • Site-directed mutagenesis of conserved residues followed by functional assays

    • Complementation experiments with chimeric constructs to identify domain-specific functions

    • Construction of deletion strains to assess the impact of specific protein regions

  • Comparative genomics and evolutionary analysis:

    • Sequence alignment of KdpC proteins from diverse species can identify conserved regions likely critical for function

    • Construction of hybrid proteins between different species' KdpC can reveal functionally interchangeable domains

These complementary approaches allow researchers to build a comprehensive understanding of KdpC's role in the transport mechanism, moving beyond correlation to establish causative relationships between structure and function.

What are the common challenges in working with recombinant KdpC and how can they be addressed?

Working with recombinant membrane proteins like KdpC presents several technical challenges. Common issues and their solutions include:

ChallengeSolution ApproachMethodological Details
Low expression levelsOptimize expression conditionsUse low temperature induction (11°C) and specialized vectors like pET series
Protein misfoldingImprove solubilization conditionsCarefully select detergents; n-decyl-β-maltoside at 0.15% has proven effective
Limited stabilityOptimize storage conditionsAdd 5-50% glycerol for long-term storage at -20°C/-80°C
Difficulty assessing functionUse complementary functional assaysCombine ATPase activity assays with transport measurements in proteoliposomes
Heterogeneity in preparationsImplement rigorous purificationUse multi-step purification including affinity and size-exclusion chromatography

For structural studies specifically, ensuring protein homogeneity is crucial. The successful strategy employed for cryo-EM studies of KdpFABC included using inhibitors to trap the complex in various discrete states and imaging these samples on Ultrafoil grids with a Titan Krios electron microscope . For functional studies, reconstituting the purified protein into liposomes with defined lipid composition allows for controlled assessment of transport activity .

How can proper data handling and analysis improve KdpC research outcomes?

Proper data handling and analysis are crucial for generating reliable and reproducible results in KdpC research. Following established best practices for tabular data management can significantly improve research quality:

  • Format data for computer readability: Avoid merged cells, color-coding, and other formatting that might hinder downstream analysis . For example, when collecting kinetic data for KdpFABC activity, maintain separate columns for each variable and avoid embedding calculations within the raw data table.

  • Separate raw data from processed results: Keep raw experimental measurements separate from analysis and visualization to preserve data integrity . This is particularly important for time-course measurements of transport activity or concentration-dependent effects.

  • Use consistent naming conventions: Establish clear file organization systems to easily locate raw data, processed results, and visualization files . This becomes especially important when comparing KdpC variants or different experimental conditions.

  • Document metadata thoroughly: Record all relevant experimental conditions, sample details, and methodological parameters alongside the data . For KdpC studies, this should include protein batch information, reconstitution conditions, buffer compositions, and instrument settings.

  • Employ appropriate statistical analyses: When comparing KdpC variants or experimental conditions, select statistical methods appropriate for the data distribution and experimental design. Document all analysis steps to ensure reproducibility.

Implementing these practices helps ensure that subtle effects in KdpC function can be reliably detected and that data can be effectively shared with collaborators or included in publications.

What are the most promising areas for further research on KdpC and the KdpFABC complex?

Several promising research directions could advance our understanding of KdpC's role in the KdpFABC complex:

  • Detailed mapping of conformational changes:

    • Using advanced techniques like single-molecule FRET to track dynamic changes during the transport cycle

    • Correlating these changes with functional states to better understand the mechanistic role of KdpC

  • Investigation of species-specific adaptations:

    • Comparative analysis of KdpC from extremophiles to identify adaptations for functioning under extreme conditions

    • Exploring evolutionary patterns to understand the diversification of KdpC function across prokaryotes

  • Exploration of potential regulatory roles:

    • Investigation of post-translational modifications that might regulate KdpC function

    • Examination of potential protein-protein interactions beyond the core complex

  • Therapeutic targeting possibilities:

    • Assessment of KdpC as a potential antimicrobial target given its essential role in bacterial potassium homeostasis

    • Design of specific inhibitors that might disrupt the function of the KdpFABC complex in pathogenic bacteria

  • Integration with cellular physiology:

    • Systems biology approaches to understand how KdpC and the KdpFABC complex integrate with broader cellular response networks

    • Investigation of potential secondary roles beyond potassium transport

These research directions would benefit from integrating cutting-edge methodologies like cryo-electron tomography, AI-driven structural prediction, and high-throughput functional screening to accelerate discovery and mechanistic understanding.

How can contradictory findings about KdpC function be reconciled through experimental design?

Contradictory findings regarding KdpC function may arise from differences in experimental systems, conditions, or interpretations. A systematic approach to reconcile these contradictions could include:

  • Standardization of experimental systems:

    • Establish consensus protocols for expression, purification, and functional assessment

    • Compare results across different expression systems to identify system-specific artifacts

  • Direct comparison of competing models:

    • Design experiments specifically targeting the points of contradiction between models

    • Use multiple complementary techniques to assess the same functional question

  • Integration of structural and functional data:

    • Correlate structural features with functional outcomes across multiple conditions

    • Use structure-guided mutagenesis to test specific hypotheses about mechanism

  • Cross-validation across species:

    • Test proposed mechanisms in KdpC from multiple bacterial species

    • Identify conserved functional features versus species-specific adaptations

  • Consideration of physiological context:

    • Examine KdpC function under different stress conditions that might reveal condition-specific behaviors

    • Assess the impact of cellular factors that might be missing in reconstituted systems

By systematically addressing contradictions through carefully designed experiments that directly test competing hypotheses, researchers can develop a more unified understanding of KdpC's role in potassium transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.