Amino Acid Sequence
The protein consists of 179 amino acids with the sequence:
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVVFGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQSVWSKLNLAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS .
YciB is a 5-pass transmembrane protein with a cytoplasmic C-terminus . Key roles include:
Directly interacts with ZipA, a critical divisome protein, influencing septum localization .
Deletion (ΔyciB) shortens cell length, while overexpression causes filamentation .
Synergizes with DcrB (an inner membrane lipoprotein) to maintain lipopolysaccharide (LPS) levels and prevent outer membrane protein (OMP) mislocalization .
Double mutants (yciB dcrB) exhibit lethal membrane vesiculation, peptidoglycan-Lpp linkages, and sensitivity to SDS-EDTA .
Strains: Use Origami™ or SHuffle® for disulfide bond formation in cytoplasmic expression .
Reconstitution: 0.1–1.0 mg/mL in sterile water with 50% glycerol for long-term stability .
KEGG: ecq:ECED1_1408
YciB has been implicated in multiple critical cellular processes, particularly those related to bacterial cell envelope synthesis. Research indicates that YciB interacts with various proteins involved in cell elongation and cell division, suggesting a role in maintaining proper cell morphology . Specifically, YciB has been found to interact with ZipA, an essential cell division protein in E. coli, suggesting that YciB may be involved in the cell envelope synthesis directed by ZipA in a PBP3-independent manner .
For recombinant YciB production, E. coli expression systems have been successfully employed. The full-length YciB protein (amino acids 1-179) can be effectively expressed with an N-terminal His-tag fusion in E. coli . When designing expression constructs, researchers should consider:
Optimal codon usage for E. coli expression
Inclusion of appropriate solubility tags (His-tag being commonly used)
Expression conditions that minimize protein aggregation for this membrane protein
The recombinant protein is typically obtained in a lyophilized powder form with greater than 90% purity as determined by SDS-PAGE . For membrane proteins like YciB, specialized detergent-based extraction methods may be necessary to maintain proper protein folding and function.
Recombinant YciB protein should be stored at -20°C/-80°C upon receipt, and aliquoting is necessary for multiple uses to avoid repeated freeze-thaw cycles, which can compromise protein integrity . For short-term storage (up to one week), working aliquots can be maintained at 4°C.
The recommended reconstitution protocol involves:
Brief centrifugation of the vial prior to opening
Reconstitution in deionized sterile water to 0.1-1.0 mg/mL
Addition of glycerol to a final concentration of 5-50% (50% being optimal) for long-term storage
Storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0
The membrane topology of YciB has been studied using dual pho-lac reporter systems . This methodology allows researchers to determine whether specific regions of the protein are located in the cytoplasm or periplasm. For similar studies, researchers could employ:
Dual Reporter Systems: Using fusion constructs with reporters like alkaline phosphatase (PhoA) and β-galactosidase (LacZ) that function in different cellular compartments
Site-Directed Mutagenesis: Creating targeted mutations at predicted transmembrane boundaries to assess effects on protein localization and function
Protease Accessibility Assays: Determining which regions of the protein are accessible to proteases in intact cells versus membrane preparations
Fluorescent Protein Fusions: Creating fusions with fluorescent proteins to visualize localization patterns in vivo
These approaches can provide complementary evidence for the predicted five-transmembrane domain structure of YciB .
YciB has been demonstrated to interact with various proteins involved in cell elongation and cell division processes using bacterial two-hybrid systems . Most notably, purified YciB protein directly interacts with ZipA, an essential protein in bacterial cell division . This interaction has significant implications for understanding YciB's role in cell envelope synthesis.
Researchers investigating YciB's protein interactions should consider:
Bacterial two-hybrid screening to identify novel interaction partners
Co-immunoprecipitation assays to confirm direct interactions
FRET or BRET assays to examine interactions in living cells
Surface plasmon resonance to quantify binding kinetics between YciB and known partners
The interaction network of YciB suggests it functions as part of larger protein complexes involved in coordinating cell envelope synthesis with cell division processes .
Research has shown that deletion mutants of yciB are particularly susceptible to low osmolarity conditions . This suggests that YciB plays a role in maintaining cell envelope integrity under osmotic stress. Additionally, YciB has been implicated in biofilm formation , which is a common bacterial stress response.
For researchers investigating YciB's role in stress responses, potential experimental approaches include:
Comparing growth curves of wild-type and ΔyciB strains under various stress conditions
Examining changes in transcription of yciB under different environmental stresses
Assessing cell morphology changes in response to stress in the presence and absence of YciB
Measuring cell envelope integrity parameters in wild-type versus mutant strains
Understanding YciB's contribution to stress responses may provide insights into bacterial adaptation mechanisms and potential targets for antimicrobial development.
The direct interaction between YciB and ZipA, an essential cell division protein, suggests that YciB plays a role in coordinating cell envelope synthesis with the cell division process . The fact that septum localization of ZipA is disturbed in ΔyciB mutants provides further evidence for this functional relationship.
This interaction has several implications for understanding bacterial cell division:
YciB may help regulate the timing of septum formation during cell division
YciB might facilitate proper localization of division machinery components
The interaction suggests a potential role for YciB in the PBP3-independent pathway of cell envelope synthesis
YciB could serve as a bridge between cell elongation and division processes
Researchers studying bacterial cell division should consider including YciB in their models of division complex assembly and regulation, particularly focusing on how membrane proteins like YciB contribute to the spatial and temporal coordination of division events.
While the current research focuses primarily on YciB in E. coli, comparative genomic and functional analyses across bacterial species could provide valuable insights into the evolutionary conservation and significance of this protein.
For researchers interested in this approach:
Bioinformatic analyses can identify YciB homologs across bacterial phyla
Functional complementation studies can test whether YciB proteins from different species can rescue E. coli ΔyciB phenotypes
Analysis of gene neighborhood conservation can identify potential functional partners that co-evolved with YciB
Study of YciB in bacteria with different cell shapes may reveal specialized functions related to morphological diversity
Such comparative studies might reveal whether YciB functions are universally conserved or have evolved specialized roles in different bacterial lineages, potentially informing our understanding of bacterial cell envelope biogenesis evolution.
As a membrane protein, YciB presents several experimental challenges that researchers should consider:
Protein Solubility Issues: Membrane proteins are often difficult to solubilize while maintaining native structure. This can be addressed by:
Optimization of detergent types and concentrations
Use of nanodiscs or amphipols to maintain membrane environment
Development of fragment-based approaches focusing on soluble domains
Functional Assays: Developing quantitative assays to measure YciB activity is challenging. Researchers might consider:
Cell-based assays measuring physiological outcomes (growth, morphology)
Reconstitution of YciB in liposomes to study membrane properties
Development of in vitro interaction assays with protein partners
Structural Studies: Obtaining high-resolution structural information on membrane proteins like YciB remains difficult. Advanced approaches include:
Cryo-electron microscopy of YciB in membrane environments
X-ray crystallography with stabilizing mutations or antibody fragments
NMR studies of specific domains or fragments
Addressing these methodological challenges would significantly advance our understanding of YciB's molecular function in bacterial cell division and envelope synthesis.
Research has documented several phenotypic changes resulting from altered yciB expression levels:
Deletion Mutants (ΔyciB):
Overexpression of yciB:
These phenotypic changes provide important clues about YciB's functional roles in bacterial cell physiology. Researchers investigating these phenotypes should employ quantitative image analysis of cell morphology, time-lapse microscopy to track division events, and detailed biochemical characterization of cell envelope components in mutant strains.
YciB appears to be involved in cell envelope synthesis through its interactions with cell elongation and division complexes . This involvement has several potential implications for antimicrobial research:
YciB or its interactions could represent novel targets for antimicrobial development, particularly agents disrupting cell envelope biogenesis
Understanding YciB function may provide insights into mechanisms of resistance to cell wall-targeting antibiotics
YciB's role in stress responses suggests it might contribute to bacterial persistence under antibiotic treatment
The protein's interactions with essential division proteins like ZipA indicate potential for synergistic antimicrobial approaches
Researchers in antimicrobial discovery could consider screening for compounds that specifically disrupt YciB functions or its protein-protein interactions, potentially leading to novel antimicrobial strategies.
Based on current knowledge, several research directions appear particularly promising:
Structural Biology: Determining the high-resolution structure of YciB would significantly advance understanding of its function and interactions.
Systems Biology: Integrating YciB into broader models of bacterial cell division and envelope synthesis networks.
Synthetic Biology: Engineering YciB variants with altered functions to probe the relationship between structure and function.
Antimicrobial Development: Exploring YciB and its interactions as potential targets for novel antimicrobial compounds.
Comparative Biology: Studying YciB homologs across diverse bacterial species to understand its evolutionary significance.
Researchers pursuing these directions will contribute to our fundamental understanding of bacterial cell biology while potentially uncovering applications in biotechnology and medicine.
The complexity of YciB's role in bacterial physiology suggests that interdisciplinary approaches may be particularly valuable:
Computational Biology + Experimental Validation: Using computational predictions of protein structure and interactions to guide targeted experiments.
Single-Cell Microscopy + Molecular Genetics: Combining high-resolution imaging with genetic manipulations to visualize YciB function in living cells.
Biophysics + Biochemistry: Applying biophysical methods to purified YciB to understand its effects on membrane properties and protein complexes.
Synthetic Biology + Systems Biology: Creating synthetic genetic circuits to probe YciB function within reconstituted systems.