Recombinant Escherichia coli O81 Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Expression

Amino Acid Sequence
The protein consists of 179 amino acids with the sequence:
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVVFGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQSVWSKLNLAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS .

Expression System

  • Host: E. coli (strains BL21(DE3) or derivatives)

  • Tag: N-terminal 10× His-tag for purification

  • Purity: >90% (verified by SDS-PAGE)

  • Form: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Characterization

YciB is a 5-pass transmembrane protein with a cytoplasmic C-terminus . Key roles include:

Cell Division Regulation

  • Directly interacts with ZipA, a critical divisome protein, influencing septum localization .

  • Deletion (ΔyciB) shortens cell length, while overexpression causes filamentation .

Envelope Integrity

  • Synergizes with DcrB (an inner membrane lipoprotein) to maintain lipopolysaccharide (LPS) levels and prevent outer membrane protein (OMP) mislocalization .

  • Double mutants (yciB dcrB) exhibit lethal membrane vesiculation, peptidoglycan-Lpp linkages, and sensitivity to SDS-EDTA .

Stress Response

  • Activates the Cpx two-component system under envelope stress .

Genetic and Proteomic Interactions

Interaction PartnerRoleConservationMethod
ZipADivisome assemblyE. coliBacterial two-hybrid
FtsI, FtsQSeptal peptidoglycan synthesisE. coli, Yersinia pestisB2H/MS
RodZ, RodACell elongationCross-speciesB2H

Phenotypic Defects

  • Single mutant (ΔyciB): Susceptible to low osmolarity and vancomycin .

  • Double mutant (yciB dcrB):

    • Fails to grow in low-salt media .

    • Accumulates OMPs (e.g., LamB, OmpA) in the inner membrane .

Recombinant Expression and Purification

Optimized Protocols

  • Strains: Use Origami™ or SHuffle® for disulfide bond formation in cytoplasmic expression .

  • Storage: Aliquot at -80°C; avoid freeze-thaw cycles .

  • Reconstitution: 0.1–1.0 mg/mL in sterile water with 50% glycerol for long-term stability .

Applications in Research

  • Mechanistic Studies: Elucidating YciB-DcrB synergy in envelope biogenesis .

  • Drug Discovery: Screening for antibiotics targeting cell division .

  • Protein Interaction Mapping: Identifying divisome/elongasome networks .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
yciB; ECED1_1408; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQSVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What cellular processes is YciB involved in?

YciB has been implicated in multiple critical cellular processes, particularly those related to bacterial cell envelope synthesis. Research indicates that YciB interacts with various proteins involved in cell elongation and cell division, suggesting a role in maintaining proper cell morphology . Specifically, YciB has been found to interact with ZipA, an essential cell division protein in E. coli, suggesting that YciB may be involved in the cell envelope synthesis directed by ZipA in a PBP3-independent manner .

What expression systems are most effective for producing recombinant YciB protein?

For recombinant YciB production, E. coli expression systems have been successfully employed. The full-length YciB protein (amino acids 1-179) can be effectively expressed with an N-terminal His-tag fusion in E. coli . When designing expression constructs, researchers should consider:

  • Optimal codon usage for E. coli expression

  • Inclusion of appropriate solubility tags (His-tag being commonly used)

  • Expression conditions that minimize protein aggregation for this membrane protein

The recombinant protein is typically obtained in a lyophilized powder form with greater than 90% purity as determined by SDS-PAGE . For membrane proteins like YciB, specialized detergent-based extraction methods may be necessary to maintain proper protein folding and function.

What are the recommended storage and handling conditions for recombinant YciB protein?

Recombinant YciB protein should be stored at -20°C/-80°C upon receipt, and aliquoting is necessary for multiple uses to avoid repeated freeze-thaw cycles, which can compromise protein integrity . For short-term storage (up to one week), working aliquots can be maintained at 4°C.

The recommended reconstitution protocol involves:

  • Brief centrifugation of the vial prior to opening

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of glycerol to a final concentration of 5-50% (50% being optimal) for long-term storage

  • Storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0

What experimental approaches can be used to study YciB membrane topology?

The membrane topology of YciB has been studied using dual pho-lac reporter systems . This methodology allows researchers to determine whether specific regions of the protein are located in the cytoplasm or periplasm. For similar studies, researchers could employ:

  • Dual Reporter Systems: Using fusion constructs with reporters like alkaline phosphatase (PhoA) and β-galactosidase (LacZ) that function in different cellular compartments

  • Site-Directed Mutagenesis: Creating targeted mutations at predicted transmembrane boundaries to assess effects on protein localization and function

  • Protease Accessibility Assays: Determining which regions of the protein are accessible to proteases in intact cells versus membrane preparations

  • Fluorescent Protein Fusions: Creating fusions with fluorescent proteins to visualize localization patterns in vivo

These approaches can provide complementary evidence for the predicted five-transmembrane domain structure of YciB .

What protein-protein interactions has YciB been shown to participate in?

YciB has been demonstrated to interact with various proteins involved in cell elongation and cell division processes using bacterial two-hybrid systems . Most notably, purified YciB protein directly interacts with ZipA, an essential protein in bacterial cell division . This interaction has significant implications for understanding YciB's role in cell envelope synthesis.

Researchers investigating YciB's protein interactions should consider:

  • Bacterial two-hybrid screening to identify novel interaction partners

  • Co-immunoprecipitation assays to confirm direct interactions

  • FRET or BRET assays to examine interactions in living cells

  • Surface plasmon resonance to quantify binding kinetics between YciB and known partners

The interaction network of YciB suggests it functions as part of larger protein complexes involved in coordinating cell envelope synthesis with cell division processes .

How does YciB contribute to bacterial stress responses?

Research has shown that deletion mutants of yciB are particularly susceptible to low osmolarity conditions . This suggests that YciB plays a role in maintaining cell envelope integrity under osmotic stress. Additionally, YciB has been implicated in biofilm formation , which is a common bacterial stress response.

For researchers investigating YciB's role in stress responses, potential experimental approaches include:

  • Comparing growth curves of wild-type and ΔyciB strains under various stress conditions

  • Examining changes in transcription of yciB under different environmental stresses

  • Assessing cell morphology changes in response to stress in the presence and absence of YciB

  • Measuring cell envelope integrity parameters in wild-type versus mutant strains

Understanding YciB's contribution to stress responses may provide insights into bacterial adaptation mechanisms and potential targets for antimicrobial development.

What are the implications of YciB's interaction with ZipA for understanding bacterial cell division?

The direct interaction between YciB and ZipA, an essential cell division protein, suggests that YciB plays a role in coordinating cell envelope synthesis with the cell division process . The fact that septum localization of ZipA is disturbed in ΔyciB mutants provides further evidence for this functional relationship.

This interaction has several implications for understanding bacterial cell division:

  • YciB may help regulate the timing of septum formation during cell division

  • YciB might facilitate proper localization of division machinery components

  • The interaction suggests a potential role for YciB in the PBP3-independent pathway of cell envelope synthesis

  • YciB could serve as a bridge between cell elongation and division processes

Researchers studying bacterial cell division should consider including YciB in their models of division complex assembly and regulation, particularly focusing on how membrane proteins like YciB contribute to the spatial and temporal coordination of division events.

How might comparative analysis of YciB across bacterial species inform its evolutionary significance?

While the current research focuses primarily on YciB in E. coli, comparative genomic and functional analyses across bacterial species could provide valuable insights into the evolutionary conservation and significance of this protein.

For researchers interested in this approach:

  • Bioinformatic analyses can identify YciB homologs across bacterial phyla

  • Functional complementation studies can test whether YciB proteins from different species can rescue E. coli ΔyciB phenotypes

  • Analysis of gene neighborhood conservation can identify potential functional partners that co-evolved with YciB

  • Study of YciB in bacteria with different cell shapes may reveal specialized functions related to morphological diversity

Such comparative studies might reveal whether YciB functions are universally conserved or have evolved specialized roles in different bacterial lineages, potentially informing our understanding of bacterial cell envelope biogenesis evolution.

What methodological challenges exist in studying YciB and how can they be addressed?

As a membrane protein, YciB presents several experimental challenges that researchers should consider:

  • Protein Solubility Issues: Membrane proteins are often difficult to solubilize while maintaining native structure. This can be addressed by:

    • Optimization of detergent types and concentrations

    • Use of nanodiscs or amphipols to maintain membrane environment

    • Development of fragment-based approaches focusing on soluble domains

  • Functional Assays: Developing quantitative assays to measure YciB activity is challenging. Researchers might consider:

    • Cell-based assays measuring physiological outcomes (growth, morphology)

    • Reconstitution of YciB in liposomes to study membrane properties

    • Development of in vitro interaction assays with protein partners

  • Structural Studies: Obtaining high-resolution structural information on membrane proteins like YciB remains difficult. Advanced approaches include:

    • Cryo-electron microscopy of YciB in membrane environments

    • X-ray crystallography with stabilizing mutations or antibody fragments

    • NMR studies of specific domains or fragments

Addressing these methodological challenges would significantly advance our understanding of YciB's molecular function in bacterial cell division and envelope synthesis.

What phenotypic changes result from genetic manipulation of yciB expression?

Research has documented several phenotypic changes resulting from altered yciB expression levels:

  • Deletion Mutants (ΔyciB):

    • Shorter cell length compared to wild-type E. coli

    • Increased susceptibility to low osmolarity conditions

    • Disrupted septum localization of ZipA

    • Abnormal biofilm formation

  • Overexpression of yciB:

    • Elongation of bacterial cells

    • Potential changes in cell division frequency

    • Altered cell envelope properties

These phenotypic changes provide important clues about YciB's functional roles in bacterial cell physiology. Researchers investigating these phenotypes should employ quantitative image analysis of cell morphology, time-lapse microscopy to track division events, and detailed biochemical characterization of cell envelope components in mutant strains.

How does YciB contribute to cell envelope synthesis and what are the implications for antimicrobial research?

YciB appears to be involved in cell envelope synthesis through its interactions with cell elongation and division complexes . This involvement has several potential implications for antimicrobial research:

  • YciB or its interactions could represent novel targets for antimicrobial development, particularly agents disrupting cell envelope biogenesis

  • Understanding YciB function may provide insights into mechanisms of resistance to cell wall-targeting antibiotics

  • YciB's role in stress responses suggests it might contribute to bacterial persistence under antibiotic treatment

  • The protein's interactions with essential division proteins like ZipA indicate potential for synergistic antimicrobial approaches

Researchers in antimicrobial discovery could consider screening for compounds that specifically disrupt YciB functions or its protein-protein interactions, potentially leading to novel antimicrobial strategies.

What are the most promising future research directions for YciB studies?

Based on current knowledge, several research directions appear particularly promising:

  • Structural Biology: Determining the high-resolution structure of YciB would significantly advance understanding of its function and interactions.

  • Systems Biology: Integrating YciB into broader models of bacterial cell division and envelope synthesis networks.

  • Synthetic Biology: Engineering YciB variants with altered functions to probe the relationship between structure and function.

  • Antimicrobial Development: Exploring YciB and its interactions as potential targets for novel antimicrobial compounds.

  • Comparative Biology: Studying YciB homologs across diverse bacterial species to understand its evolutionary significance.

Researchers pursuing these directions will contribute to our fundamental understanding of bacterial cell biology while potentially uncovering applications in biotechnology and medicine.

What interdisciplinary approaches might yield new insights into YciB function?

The complexity of YciB's role in bacterial physiology suggests that interdisciplinary approaches may be particularly valuable:

  • Computational Biology + Experimental Validation: Using computational predictions of protein structure and interactions to guide targeted experiments.

  • Single-Cell Microscopy + Molecular Genetics: Combining high-resolution imaging with genetic manipulations to visualize YciB function in living cells.

  • Biophysics + Biochemistry: Applying biophysical methods to purified YciB to understand its effects on membrane properties and protein complexes.

  • Synthetic Biology + Systems Biology: Creating synthetic genetic circuits to probe YciB function within reconstituted systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.