Recombinant Escherichia coli O81 Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ubiB; ECED1_4539; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMPNRHKDKPLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGLPVEA WFDDFEIKPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIKADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLYIPEVYPDYCSEGM MVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELPELVYDSLRQGKYLQH SVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFLLVSRPEWGLMPGWLMAGGLIAWFV GWRKTR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UbiB and what is its primary role in bacterial metabolism?

UbiB (Uniprot accession number B7N2E3 for E. coli O81 strain ED1a) is a 546-amino acid protein involved in ubiquinone biosynthesis. Ubiquinone, also known as coenzyme Q, is an essential component of the electron transport chain critical for bacterial respiration. Initially, UbiB was believed to catalyze the first hydroxylation step in ubiquinone biosynthesis, but recent evidence suggests that UbiI, not UbiB, performs this function . Current research indicates that UbiB likely functions as a putative kinase involved in coenzyme Q synthesis, though detailed mechanistic studies validating this activity are still lacking . This represents a significant paradigm shift in our understanding of the ubiquinone biosynthetic pathway. UbiB's importance lies in its contribution to respiratory metabolism, which directly impacts bacterial energy production, adaptation to varying oxygen levels, and survival in diverse environments.

What structural elements characterize the UbiB protein?

The full-length UbiB protein from E. coli O81 (strain ED1a) consists of 546 amino acids with a distinct amino acid sequence that lacks the conserved motifs typically found in hydroxylases . This structural characteristic provided the first indication that its initially assigned function might be incorrect. Although detailed three-dimensional structural information remains limited, sequence analysis suggests features more consistent with kinase activity. When expressed as a recombinant protein, UbiB requires specific storage conditions, typically in Tris-based buffer with 50% glycerol to maintain stability . For research purposes, the protein should be stored at -20°C or -80°C for extended storage, with working aliquots maintained at 4°C for no more than one week . Repeated freeze-thaw cycles are detrimental to protein integrity and activity, a critical consideration for experimental design and planning.

How does UbiB compare to other proteins in the ubiquinone biosynthesis pathway?

Within the ubiquinone biosynthesis pathway, UbiB represents one component of a complex enzymatic network that includes UbiA, UbiD, UbiI, UbiG, UbiH, UbiE, UbiF, UbiX, UbiJ, and UbiK . While the functions of many of these proteins have been characterized - UbiA (prenylation), UbiX and UbiD (decarboxylation), UbiE and UbiG (methylation), UbiH, UbiI, and UbiF (hydroxylation) - UbiB's precise role remains less defined, along with those of UbiJ and UbiK . Recent research has revealed that UbiJ and UbiK form a complex that interacts with the major lipid palmitoleic acid in E. coli . This interaction suggests a potential role in facilitating the association of pathway components with the membrane, where ubiquinone is ultimately localized. Unlike the O2-dependent hydroxylases (UbiH, UbiI, UbiF) that require molecular oxygen as a substrate, UbiB likely functions through a different mechanism, potentially involving phosphorylation reactions. Understanding these distinctions is crucial for mapping the complete pathway of ubiquinone biosynthesis.

What are the optimal methods for recombinant expression and purification of UbiB?

Successful expression and purification of recombinant UbiB requires careful optimization of multiple experimental parameters. Based on established protocols for similar bacterial proteins, researchers should consider the following methodological approach:

Expression system selection is critical, with E. coli BL21(DE3) strains commonly used for expressing bacterial proteins. Expression vectors containing strong inducible promoters (T7, tac) facilitate controlled protein production. For UbiB from E. coli O81, expression typically employs a tag determined during the production process to facilitate purification .

Culture conditions significantly impact yield and quality. Optimal expression often occurs at lower temperatures (16-25°C) following induction at mid-log phase (OD600 0.6-0.8) with moderate inducer concentrations (0.1-0.5 mM IPTG). The addition of protease inhibitors during cell lysis helps preserve protein integrity.

Purification typically involves affinity chromatography based on the selected tag, followed by size exclusion chromatography to separate UbiB from contaminants. Buffer optimization is crucial, with Tris-based buffers (pH 7.5-8.0) containing glycerol (25-50%) recommended for maintaining stability . The purified protein requires storage at -20°C or -80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise activity . These methodological considerations are essential for obtaining functional UbiB protein for subsequent biochemical and structural studies.

How can researchers effectively measure and characterize UbiB activity?

Characterizing UbiB activity presents unique challenges due to evolving understanding of its function. Based on current evidence suggesting kinase activity rather than hydroxylase function, researchers should employ multiple complementary approaches:

For kinase activity assessment, researchers can monitor ATP consumption using luciferase-based assays or track phosphate transfer using radioactive ATP (γ-32P-ATP). Mass spectrometry approaches can identify potential phosphorylated substrates or intermediates in the ubiquinone pathway. Activity assays should include appropriate controls to distinguish UbiB-specific activity from background phosphorylation.

Genetic complementation studies provide functional validation, determining whether wild-type UbiB can restore ubiquinone production in ubiB knockout strains. Mutational analysis of potential catalytic residues can pinpoint amino acids essential for function. Comparing ubiquinone levels between wild-type and ubiB mutant strains using HPLC or LC-MS quantifies UbiB's contribution to the pathway .

Biochemical characterization should also assess potential cofactor requirements, substrate specificity, and kinetic parameters. Given UbiB's putative role as a kinase, experiments should examine its interaction with various potential substrates, including pathway intermediates and other proteins in the ubiquinone biosynthesis pathway. These multifaceted approaches collectively provide a comprehensive assessment of UbiB's functional properties.

What techniques are most effective for studying UbiB's interactions with other pathway components?

Elucidating UbiB's interactions with other proteins in the ubiquinone biosynthesis pathway requires sophisticated methodological approaches that capture both transient and stable interactions. Researchers should implement a combination of the following techniques:

Affinity-based methods such as co-immunoprecipitation (Co-IP) and pull-down assays can identify protein complexes containing UbiB, though these require antibodies against UbiB or expression with affinity tags. Bacterial two-hybrid systems provide an in vivo approach to detect direct protein-protein interactions, offering advantages for membrane-associated complexes.

Advanced biophysical methods including surface plasmon resonance (SPR) and isothermal titration calorimetry (ITC) quantify binding affinities and thermodynamic parameters. Cross-linking mass spectrometry (XL-MS) identifies proteins in close proximity to UbiB, providing spatial information about interaction interfaces. Blue native polyacrylamide gel electrophoresis (BN-PAGE) helps identify native protein complexes containing UbiB.

Microscopy techniques such as Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) visualize interactions in living cells. Structural studies using X-ray crystallography or cryo-electron microscopy of UbiB in complex with interaction partners provide the most detailed characterization of binding interfaces and interaction mechanisms. This multilayered approach builds a comprehensive interaction network surrounding UbiB within the ubiquinone biosynthesis pathway.

How might UbiB's putative kinase activity contribute to ubiquinone biosynthesis?

UbiB's reclassification from a hydroxylase to a putative kinase has profound implications for understanding ubiquinone biosynthesis regulation. If UbiB indeed functions as a kinase, it likely phosphorylates specific substrates within the pathway, potentially creating binding sites for other proteins, altering substrate accessibility, or directly activating catalytic functions . This phosphorylation-based regulatory mechanism would introduce an additional layer of control in ubiquinone biosynthesis.

Kinase activity would necessarily couple ubiquinone production to cellular energetics through ATP consumption, potentially allowing bacteria to adjust ubiquinone synthesis according to cellular energy status. Such coupling would be particularly advantageous for facultative anaerobes like E. coli that must adapt to environments with varying oxygen availability, where energy production and respiratory requirements fluctuate substantially.

Another intriguing possibility is that UbiB mediates cross-talk between ubiquinone biosynthesis and other cellular processes through shared phosphorylation targets or cascades. Such integration would allow coordinated regulation of respiratory metabolism with other aspects of bacterial physiology. Identifying UbiB's substrates and phosphorylation sites remains a critical research priority that will substantially advance our understanding of how ubiquinone biosynthesis is regulated in response to changing environmental conditions and metabolic demands.

What is the relationship between UbiB-mediated ubiquinone biosynthesis and the O2-independent pathway?

E. coli employs two distinct ubiquinone biosynthesis pathways: the classical O2-dependent pathway involving UbiB and a recently discovered O2-independent pathway controlled by ubiT, ubiU, and ubiV genes . This dual pathway system represents a sophisticated adaptation allowing ubiquinone production across the entire spectrum of oxygen conditions. The pathways share enzymes involved in prenylation (UbiA), decarboxylation (UbiX and UbiD), and methylation (UbiE and UbiG) but differ in their hydroxylases and accessory factors .

In the O2-dependent pathway, hydroxylation reactions are catalyzed by flavin monooxygenases UbiF, UbiI, and UbiH that require molecular oxygen as a substrate. Conversely, in the O2-independent pathway, the UbiU-UbiV complex performs hydroxylation through a unique O2-independent process, potentially using novel mechanisms to insert oxygen atoms without molecular oxygen . UbiT contains a lipid-binding SCP2 domain and likely functions as an accessory factor facilitating pathway operation under anaerobic conditions .

Experimental evidence indicates the presence of both pathways is critical for bacterial adaptability. The O2-independent pathway enables essential processes under anaerobic conditions, including nitrate respiration and uracil biosynthesis . The UbiB-dependent O2-dependent pathway allows maximal energy production under aerobic conditions. Interestingly, when E. coli transitions from anaerobic to aerobic conditions, UbiT plays a crucial role in facilitating this metabolic shift . This dual pathway system exemplifies bacterial metabolic plasticity, allowing survival and growth across diverse environmental niches with varying oxygen availability.

How do mutations in ubiB affect bacterial growth and metabolism under different environmental conditions?

Analysis of metabolic profiles in ubiB mutants reveals broader effects beyond respiratory capacity. With decreased ubiquinone availability, electron flow through the respiratory chain becomes compromised, potentially increasing oxidative stress through electron leakage. Additionally, ubiB mutations may trigger metabolic rewiring, including increased reliance on fermentative pathways under aerobic conditions where such metabolism would normally be suppressed.

Recent research has connected these metabolic adaptations to phenotypes relevant for bacterial pathogenesis and community dynamics. Evidence suggests that ubiquinone biosynthesis impacts bacterial colonization capacity, with the O2-independent pathway contributing to bacterial multiplication in the mouse gut, albeit modestly . The UbiUV-dependent pathway also proves essential for nitrate respiration and pyrimidine biosynthesis under anaerobic conditions . These findings highlight how mutations affecting ubiquinone biosynthesis can influence bacterial fitness beyond simple growth rate effects, extending to adaptation in complex ecological niches like the gut microbiota.

Why was UbiB initially mischaracterized, and what does this teach us about protein function annotation?

The hydroxylase activity initially attributed to UbiB was later correctly assigned to UbiI, highlighting how functional redundancy and complex metabolic networks can complicate phenotypic interpretation . Without direct biochemical verification of enzymatic activity, genetic evidence alone proved insufficient for accurate function determination. This case demonstrates how experimental approaches must evolve beyond purely genetic methods to include direct biochemical characterization, structural analysis, and systems-level investigation.

This mischaracterization carries broader lessons for protein function annotation in the post-genomic era. It underscores the danger of function assignment based solely on mutant phenotypes without supporting biochemical evidence. It highlights the value of integrating multiple lines of evidence—genetic, biochemical, structural, and evolutionary—when determining protein function. Finally, it emphasizes the importance of maintaining scientific flexibility, allowing functional reassignment when new evidence contradicts established beliefs. The UbiB case demonstrates how initial functional misassignments can persist in scientific literature, requiring substantial evidence to correct prevailing paradigms.

What methodological challenges complicate the study of UbiB's precise biochemical function?

Investigating UbiB's biochemical function presents several significant methodological challenges that have contributed to its enigmatic status. The primary difficulty lies in establishing reliable in vitro activity assays when the precise function (kinase versus hydroxylase) and substrates remain uncertain. Without confirmed substrates, researchers must test multiple candidate molecules, often with limited guidance on reaction conditions and detection methods.

Protein stability presents another substantial challenge. UbiB, like many membrane-associated proteins, may require specific lipid environments or detergents to maintain its native conformation and activity . The recommendation for storage in 50% glycerol suggests stability issues that could complicate activity measurements . Additionally, if UbiB functions as part of a multi-protein complex, isolating the protein may disrupt essential interactions required for activity.

The dual pathway system for ubiquinone biosynthesis further complicates experimental design and interpretation. Redundancy between the O2-dependent and O2-independent pathways means that phenotypic analysis of single mutants may show minimal effects under certain conditions due to pathway compensation . This necessitates careful experimental design with appropriate controls and consideration of oxygen conditions.

Overcoming these challenges requires innovative approaches including reconstitution of minimal ubiquinone biosynthesis systems in vitro, development of sensitive assays for potential kinase activity, structural studies to identify possible substrate binding sites, and comprehensive mutational analysis targeting potential catalytic residues. These methodological advances will be essential for definitively establishing UbiB's biochemical function.

What are the most significant knowledge gaps in current understanding of UbiB function?

Despite decades of research on ubiquinone biosynthesis, several critical knowledge gaps remain regarding UbiB's precise function. The most fundamental gap concerns UbiB's enzymatic activity – while evidence suggests kinase function, direct biochemical confirmation with identified substrates and measured kinetic parameters is lacking . If UbiB indeed functions as a kinase, its specific substrates, whether proteins or metabolic intermediates, remain unknown.

The structural basis of UbiB function represents another significant knowledge gap. Without high-resolution structures, understanding how UbiB interacts with substrates, cofactors, and other pathway components remains speculative. Such structural information would provide crucial insights into its catalytic mechanism and potential regulatory interactions.

The regulatory aspects of UbiB activity constitute a third major knowledge gap. How UbiB function responds to changing environmental conditions (oxygen levels, nutrient availability, stress) remains poorly understood. The mechanisms controlling UbiB expression, potential post-translational modifications, and integration into broader regulatory networks require further investigation.

Finally, the evolutionary context of UbiB presents intriguing questions. Different bacterial species exhibit varying respiratory adaptations to environmental niches, raising questions about how UbiB function might differ across species. Understanding whether UbiB represents an ancestral feature of ubiquinone biosynthesis or a more recent adaptation could provide insights into the evolution of respiratory metabolism in bacteria.

What emerging technologies could help resolve UbiB's specific molecular function?

Resolving UbiB's molecular function will require innovative application of cutting-edge technologies across multiple research domains. High-resolution structural studies using cryo-electron microscopy (cryo-EM) or X-ray crystallography could capture UbiB alone and in complex with potential substrates or interaction partners, providing essential insights into binding interfaces and catalytic mechanisms. Recent advances in membrane protein structural biology, including the use of nanodiscs and lipid cubic phase crystallization, may overcome historical challenges in structural determination.

Advanced mass spectrometry approaches offer powerful tools for functional elucidation. Activity-based protein profiling can identify proteins modified by UbiB, while cross-linking mass spectrometry maps protein interaction networks surrounding UbiB. Hydrogen-deuterium exchange mass spectrometry can reveal conformational changes associated with substrate binding or catalysis. Metabolomic approaches using stable isotope labeling could trace the flow of substrates through the ubiquinone biosynthesis pathway, identifying UbiB-dependent steps.

Synthetic biology approaches represent another promising direction. Reconstitution of minimal ubiquinone biosynthesis systems in artificial membrane vesicles or liposomes could allow controlled testing of UbiB function independent of cellular complexity. Designer cell systems with orthogonal ubiquinone pathways could enable clean genetic backgrounds for functional testing. These complementary technological approaches, applied systematically, have the potential to definitively resolve UbiB's molecular function and place it in the broader context of bacterial metabolism.

How might understanding UbiB function contribute to insights about bacterial adaptation to environmental stress?

Understanding UbiB function has broader implications for bacterial stress adaptation beyond ubiquinone biosynthesis. Since ubiquinone plays a central role in respiratory metabolism, UbiB potentially represents a regulatory node connecting energy production to environmental adaptation. The O2-dependent ubiquinone biosynthesis pathway involving UbiB works alongside the O2-independent pathway (UbiU, UbiV, UbiT) to ensure ubiquinone availability across varying oxygen conditions . This dual pathway system exemplifies the sophisticated metabolic flexibility that allows bacteria to thrive across diverse ecological niches.

Recent research indicates that ubiquinone biosynthesis impacts bacterial responses to multiple stressors beyond oxygen limitation. The anaerobic ubiquinone pathway contributes to nitrate respiration and pyrimidine biosynthesis , linking respiratory metabolism to DNA/RNA synthesis and nitrogen metabolism. Additionally, UbiT plays a crucial role in facilitating efficient transitions from anaerobic to aerobic conditions , demonstrating its importance in rapid adaptation to changing environments.

These connections position UbiB research to provide insights into fundamental questions of bacterial physiology, including how metabolism reorganizes during environmental transitions, how respiratory pathways integrate with broader cellular processes, and how these adaptations influence bacterial community dynamics and host-microbe interactions. By elucidating UbiB's precise role in this adaptive network, researchers may uncover principles of metabolic regulation applicable across diverse bacterial species facing environmental stress.

What potential biotechnological and medical applications might emerge from UbiB research?

Research on UbiB and ubiquinone biosynthesis pathways opens avenues for diverse biotechnological and medical applications. In antimicrobial development, the dual pathway system for ubiquinone biosynthesis presents a potential vulnerability in bacterial metabolism that could be targeted by novel therapeutics. Compounds selectively inhibiting both O2-dependent and O2-independent pathways could effectively eliminate the metabolic flexibility that allows pathogens to adapt to varying host environments . The anaerobic pathway components (UbiU, UbiV, UbiT) may be particularly attractive targets for addressing infections in low-oxygen niches.

For metabolic engineering applications, detailed understanding of ubiquinone biosynthesis could enable optimization of electron transport chain efficiency in industrial bacterial strains. This might enhance production of biofuels, bioplastics, or other valuable metabolites where energy metabolism represents a limiting factor. Engineering strains with modified ubiquinone content could create bacteria optimized for specific industrial processes with varying oxygen availability.

In probiotic development, knowledge of how ubiquinone biosynthesis contributes to bacterial colonization and competition in the gut microbiome could inform the design of more effective probiotic strains with enhanced survival and persistence. Additionally, as coenzyme Q (ubiquinone) supplements are used therapeutically in humans, improved understanding of bacterial biosynthesis pathways could potentially inform more efficient production methods or lead to novel derivatives with enhanced properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.