Recombinant Escherichia coli O81 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Species origin: Escherichia coli O81 (strain ED1a)
UniProt ID: B7MZC7
Protein length: 291 amino acids

Enzymatic Function and Mechanism

Lgt transfers an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of prolipoproteins, forming a thioether bond . Key mechanistic insights include:

Catalytic Requirements

  • Substrates:

    • Phosphatidylglycerol (lipid donor)

    • Prolipoproteins with conserved N-terminal cysteine

  • Essential residues:

    ResidueRoleFunctional Impact
    Y26Stabilizes lipid intermediateLoss abolishes activity
    N146Coordinates catalytic stepsCritical for diacylglyceryl transfer
    R239Membrane interaction85% activity reduction when mutated

In vitro activity assays using fluorescent lipoGFP substrates demonstrate a V<sub>max</sub> of 12.3 ± 1.4 nmol/min/mg and K<sub>m</sub> of 8.2 μM for prolipoprotein substrates .

Antimicrobial Target Validation

ParameterLgt Depletion EffectSource
Outer membrane integrityIncreased permeability (↑ 78% NPN uptake)
Serum resistance98% reduction in survival
Antibiotic synergy32-fold MIC reduction for azithromycin

A CRISPRi knockdown study showed 99.7% viability loss in E. coli BW25113 within 4 hr post-Lgt inhibition .

Complementation Studies

Lgt VariantGrowth Rescue Efficiency*
Wild-type100%
Y26A0%
R239A15%
Measured in Δlgt E. coli* BW25113

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; ECED1_3284; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lgt and what is its role in bacterial cell biology?

Prolipoprotein diacylglyceryl transferase (lgt) is the first enzyme in the lipoprotein modification pathway in Gram-negative bacteria. In Escherichia coli, lgt catalyzes the transfer of a diacylglyceryl (DAG) moiety from phosphatidylglycerol onto the cysteine residue of preprolipoproteins, forming a thioether-linked prolipoprotein. This modification is essential for proper lipoprotein anchoring in the bacterial cell envelope . The lipoprotein modification process continues with Signal peptidase II (Lsp) cleaving the signal peptide, followed by apolipoprotein N-acyltransferase (Lnt) transferring a fatty acid from phosphatidylethanolamine, resulting in a triacylated mature lipoprotein . This three-step process is critical for bacterial physiology and cell envelope integrity.

Why is lgt essential for E. coli viability?

Mutations in lgt are lethal in Escherichia coli and other Gram-negative organisms under normal growth conditions . The essentiality of lgt stems from its critical role in modifying numerous lipoproteins that function in cell envelope maintenance, nutrient acquisition, and stress response. Recent research has demonstrated that lgt remains essential for growth and viability of E. coli even in the absence of Lpp (Braun's lipoprotein), which is the most abundant protein in E. coli . This finding highlights that other lipoproteins beyond Lpp play vital roles in bacterial physiology. Without functional lgt, the entire lipoprotein processing pathway is disrupted, resulting in compromised cell envelope integrity and ultimately cell death.

What are the conserved catalytic domains in E. coli lgt?

Despite relatively low sequence identity (20-40%) between lgt homologs across bacterial species, E. coli lgt contains several highly conserved functional domains essential for its enzymatic activity. These include:

  • The HGGL motif (corresponding to residues 115-118 in H. pylori lgt), which is predicted to bind to the peptide substrate

  • Conserved residues R143 and E151, which are predicted to bind phosphatidyl glycerol

  • An H-bond network consisting of R143, R239, E243, and R246 that catalyzes the transfer of diacylglycerol to the preprolipoprotein

How can researchers generate and maintain viable lgt-deleted E. coli strains?

Creating viable lgt-deleted E. coli strains requires a complementation strategy due to the gene's essential nature. A methodological approach includes:

  • First introduce a temperature-sensitive plasmid carrying a functional lgt gene (e.g., from Vibrio cholerae) that allows growth at 30°C

  • Delete the chromosomal lgt gene using homologous recombination with a construct containing upstream and downstream regions of lgt fused together

  • Introduce a selectable marker (e.g., kanamycin resistance gene flanked by loxP sites) to facilitate selection

  • Transfer the plasmid via conjugation or transformation into the target E. coli strain

  • Select for successful deletion using appropriate antibiotics and temperature conditions

  • Replace the temperature-sensitive plasmid with a temperature-insensitive expression vector carrying a functional lgt gene

  • Culture at 39°C to select only cells containing the stable complementing plasmid

This approach has been successfully used to generate lgt-deleted strains complemented with the V. cholerae lgt gene, providing a platform for antibiotic-free plasmid maintenance and recombinant protein expression.

What expression systems work effectively with lgt-complemented strains?

Lgt-complemented strains are compatible with various expression systems, with the tac promoter under LacI repressor control being particularly effective. When implementing an expression system in lgt-complemented strains, researchers should:

  • Design expression vectors that include both the complementing lgt gene and the gene of interest

  • Utilize inducible promoters (e.g., tac promoter) for controlled expression

  • Include appropriate regulatory elements (LacI repressor) for expression control

  • Design experiments with both induced and non-induced cultures as controls

This approach has been successfully used to express diverse recombinant proteins, including soluble cytoplasmic proteins like glutathione S-transferase (GST) and proteins forming insoluble inclusion bodies like CTB::p45 fusion protein . IPTG induction provides effective control over expression levels, allowing researchers to optimize protein production while maintaining strain viability.

How can the lgt complementation system be transferred to other Gram-negative bacteria?

The lgt complementation strategy can be adapted to other Gram-negative bacteria through these methodological steps:

  • Identify and delete the native lgt gene in the target organism

  • Complement with a heterologous lgt gene (typically from E. coli or V. cholerae)

  • Design temperature-sensitive or other conditional systems appropriate for the target organism

  • Verify functional complementation through growth assays and lipoprotein modification analysis

This approach has been successfully demonstrated with reciprocal constructions between E. coli and V. cholerae . The resulting V. cholerae strain with its native lgt deleted and complemented with E. coli lgt was successfully used to produce recombinant cholera toxin B subunit (CTB), a component of licensed and developmental oral cholera vaccines. This demonstrates the versatility of the system across different Gram-negative bacterial species, though it's important to note that not all lgt homologs can functionally complement each other across species .

How does the lgt-based selection system compare to antibiotic selection for plasmid stability?

The lgt-based selection system offers several advantages over traditional antibiotic selection methods, as outlined in the comparative table below:

Parameterlgt-based SelectionAntibiotic Selection
Selection mechanismEssential gene complementationAntibiotic resistance
Long-term stabilityExtreme stability without selection pressureRapid plasmid loss without continuous selection
Environmental impactNo antibiotics releasedPotential spread of resistance genes
Product purityNo antibiotic residues in final productsPotential contamination with antibiotics
Growth media requirementsStandard media, no special supplementsRequires antibiotics in media
ScalabilityWell-suited for industrial-scale productionLess suitable due to antibiotic costs and regulations
Regulatory considerationsPotentially more favorable for pharmaceutical applicationsMore regulatory hurdles due to antibiotic use

Research demonstrates that lgt-complementing plasmids maintain extreme stability in the absence of any antibiotic selection over extended periods, while corresponding plasmids with antibiotic markers in parental strains are rapidly lost without continuous selection pressure . This system contributes to reducing the spread of antibiotic resistance genes, decreasing antibiotic release into the environment, and eliminating potential contamination of final products with harmful antibiotic residues.

How can researchers analyze lgt function through cross-species complementation studies?

Cross-species complementation studies provide valuable insights into lgt function and evolution through these methodological approaches:

  • Delete the chromosomal lgt gene from the target organism

  • Express lgt homologs from different bacterial species in the deletion strain

  • Assess viability, growth characteristics, and morphology

  • Analyze lipoprotein modification patterns using mass spectrometry or radiolabeling

  • Compare protein expression levels of different homologs using Western blotting

Research has shown that while V. cholerae lgt can functionally complement an E. coli lgt deletion, Salmonella enterica lgt cannot restore normal morphology and viability despite similar expression levels . These findings reveal subtle functional differences between lgt homologs that may relate to species-specific adaptations in lipoprotein processing. Researchers can exploit these differences to study the evolutionary adaptations of lgt and potentially develop species-specific targeting strategies.

What is the relationship between lgt function and bacterial cell envelope stress?

Lgt function is intimately connected to bacterial cell envelope stress through several mechanisms:

  • Disruption of lgt activity leads to accumulation of unmodified preprolipoproteins

  • Proper lipoprotein modification is essential for cell envelope integrity

  • Cell envelope stress response pathways are activated when lipoprotein processing is compromised

Research approaches to study this relationship include:

  • Using conditional expression systems to modulate lgt levels

  • Applying chemical inhibitors of lgt activity to create controlled stress conditions

  • Monitoring activation of envelope stress response pathways (e.g., σE, Cpx, Rcs)

  • Screening for genetic suppressors that allow growth with reduced lgt function

A screen for cell envelope stress has identified inhibitors of lgt in E. coli, providing chemical tools to study this essential process without complete gene deletion . These approaches offer insights into bacterial adaptation mechanisms and potential vulnerabilities that could be exploited for antimicrobial development.

What are common challenges when working with lgt-deleted strains and how can they be addressed?

Researchers working with lgt-deleted strains often encounter several technical challenges:

  • Genetic instability - Spontaneous suppressors may arise to compensate for lgt deficiency

    • Solution: Regular verification of the lgt deletion by PCR and sequencing

    • Monitor for unexpected colony morphologies or growth patterns

  • Temperature management with temperature-sensitive systems

    • Solution: Precise temperature control in incubators and shakers

    • Include wild-type controls at each temperature point

  • Reduced growth rates of complemented strains

    • Solution: Optimize media composition and extend growth periods

    • Adjust inoculation ratios for consistent culture densities

  • Variable protein expression

    • Solution: Careful optimization of induction conditions

    • Test multiple induction times and inducer concentrations

Researchers have successfully addressed these challenges through careful experimental design, including the use of appropriate controls and monitoring systems. For example, when generating lgt-deleted strains, a stepwise approach involving temperature-sensitive plasmids, resistance markers flanked by loxP sites, and screening on sucrose-containing media has proven effective .

How can protein expression be optimized in lgt-complemented expression systems?

Optimizing protein expression in lgt-complemented systems requires balancing complementation with target protein production:

  • Promoter selection:

    • The tac promoter under LacI control provides effective inducible expression

    • Consider testing alternative promoters with different strength or regulation mechanisms

  • Induction optimization:

    • Systematically test IPTG concentrations (typically 0.1-1.0 mM)

    • Evaluate induction at different growth phases (early, mid, or late logarithmic)

    • Compare short vs. extended induction periods

  • Growth conditions:

    • Optimize temperature, considering the balance between protein folding and growth

    • Test different media compositions to enhance protein yield

    • Consider supplementation with cofactors or amino acids relevant to the target protein

  • Monitoring expression:

    • Implement parallel induced and non-induced controls

    • Analyze both soluble and insoluble fractions to detect protein aggregation

Research has demonstrated successful expression of diverse proteins using this system, including soluble cytoplasmic proteins (GST), proteins forming inclusion bodies (CTB::p45), and secreted proteins (CTB) . Each protein may require specific optimization of these parameters for maximum yield and quality.

What controls should be included in experiments investigating lgt function and complementation?

Robust experimental design for studying lgt function should include these essential controls:

  • Strain controls:

    • Wild-type parental strain with intact chromosomal lgt

    • lgt-deleted strain with empty vector

    • lgt-deleted strain complemented with homologous lgt gene

  • Expression controls:

    • Non-induced cultures growing under identical conditions

    • Time course sampling to track expression dynamics

    • Western blot analysis to confirm lgt protein levels

  • Functionality controls:

    • Growth rate measurements under various conditions

    • Cell morphology analysis by microscopy

    • Lipoprotein modification analysis

  • Cross-species controls:

    • Expression of multiple lgt homologs for comparative analysis

    • Verification of protein levels by Western blotting

    • Growth and morphology assessment for each homolog

For comprehensive analysis, researchers typically compare induced and non-induced cultures to establish baseline expression levels and determine induction efficiency . For complementation studies, expressing various lgt homologs in wild-type and lgt-deleted E. coli allows comparison of protein levels and functional complementation across species .

How conserved is lgt structure and function across bacterial species?

Lgt exhibits a pattern of structural and functional conservation with sequence divergence across bacterial species:

Conserved elements include the HGGL motif for peptide substrate binding, residues involved in phosphatidyl glycerol binding (R143, E151 in E. coli), and H-bond networks (R143, R239, E243, R246 in E. coli) that catalyze diacylglycerol transfer . This conservation pattern makes lgt an interesting subject for studying bacterial evolution and a potential target for broad-spectrum antimicrobial development.

How does the lipoprotein modification pathway differ between bacterial groups?

The lipoprotein modification pathway shows both conservation and variation across bacterial taxa:

  • Pathway conservation:

    • The first two steps (lgt and Lsp-mediated modifications) are consistent across bacteria

    • Essential nature of these enzymes is maintained in most Gram-negative bacteria

  • Variability in N-acylation:

    • The third step (Lnt-mediated modification) varies between bacterial groups

    • Lnt is essential in γ-proteobacteria but not in other proteobacteria

  • Lipoprotein distribution:

    • Certain lipoproteins like Lpp (Braun's lipoprotein) are restricted to specific bacterial clades

    • Lpp is limited to a subclade of γ-proteobacteria

  • Cross-complementation patterns:

    • Some lgt homologs can functionally replace each other across species

    • Others show species-specific functionality despite similar expression levels

These differences reflect evolutionary adaptations to different bacterial cell envelope architectures and environmental niches. Understanding these variations can inform the development of species-specific targeting strategies and provide insights into bacterial evolution.

What experimental approaches can identify subtle functional differences between lgt homologs?

To detect and characterize subtle functional differences between lgt homologs, researchers can employ these methodological approaches:

  • Cross-complementation studies:

    • Express lgt homologs from different species in lgt-deleted E. coli

    • Assess growth, morphology, and viability under various conditions

    • Quantify complementation efficiency through growth rate measurements

  • Biochemical characterization:

    • Purify lgt homologs for in vitro activity assays

    • Compare substrate specificity using synthetic preprolipoprotein substrates

    • Measure kinetic parameters (Km, Vmax) with various phospholipid donors

  • Structural biology:

    • Determine crystal structures or create homology models of lgt homologs

    • Identify variations in substrate-binding pockets and catalytic sites

    • Perform molecular dynamics simulations to assess protein flexibility and substrate interactions

  • Chimeric protein analysis:

    • Create domain-swapped versions of lgt homologs

    • Identify regions responsible for functional differences

    • Map critical species-specific residues

Research has demonstrated that despite similar expression levels, some lgt homologs (like S. enterica lgt) cannot functionally complement E. coli lgt deletion while others (like V. cholerae lgt) can . These approaches can reveal the molecular basis for these differences and provide insights into the evolution of this essential bacterial enzyme.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.