Recombinant Escherichia coli O81 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type determination occurs during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB; ECED1_0621; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTTH
Uniprot No.

Target Background

Function

Important Function: Reduces intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CrcB homolog in E. coli?

CrcB in E. coli functions primarily as a modulator of DNA topology rather than as a direct transcriptional regulator. Unlike traditional transcription factors that bind directly to promoter regions, CrcB's regulatory effects are mediated through alterations in DNA structure when the protein is overexpressed . This mechanism represents an indirect form of gene regulation that affects DNA-dependent processes including replication, recombination, and transcription.

The protein participates in cellular processes related to DNA maintenance and potentially stress response pathways. While not as extensively characterized as other recombination proteins, CrcB's role in DNA topology suggests it may impact chromosome organization and stability during replication and repair processes.

How can researchers clone and express recombinant CrcB homolog from E. coli O81?

Cloning and expression of recombinant CrcB follows methodologies similar to those used for other E. coli proteins. A recommended protocol includes:

  • PCR amplification of the crcB gene using primers with appropriate restriction sites (similar to the approach used for ybdG in the literature)

  • Cloning into an expression vector with a suitable promoter system (e.g., pTrc or pET series vectors)

  • Introduction of affinity tags (such as His6) for purification purposes

  • Transformation into an expression host strain (typically E. coli BL21(DE3) or derivatives)

  • Expression induction and protein purification

For optimal expression, consider these methodological details:

  • Design primers to include restriction sites for directional cloning (NcoI at the start and XhoI at the stop codon position has proven effective for similar proteins)

  • Verify the cloned sequence before expression to ensure no mutations occurred during amplification

  • Test multiple induction conditions (temperature, IPTG concentration, induction time) to optimize protein yield

  • Consider codon optimization if expression levels are low

What experimental approaches are most effective for studying CrcB interactions with DNA?

Several complementary techniques provide robust data on CrcB-DNA interactions:

Electrophoretic Mobility Shift Assays (EMSA):

  • Mix purified recombinant CrcB with labeled DNA fragments

  • Analyze mobility shifts indicating protein-DNA complex formation

  • Include competition assays with unlabeled DNA to determine binding specificity

Atomic Force Microscopy (AFM):

  • Visualize CrcB-DNA complexes directly

  • Observe topological changes induced by CrcB binding

  • Quantify structural parameters of DNA before and after CrcB interaction

Chromatin Immunoprecipitation (ChIP):

  • Map genome-wide CrcB binding sites in vivo

  • Compare binding profiles under different growth conditions

  • Identify potential regulatory targets

DNA Topology Assays:

  • Measure supercoiling changes in reporter plasmids

  • Use DNA gyrase assays to detect CrcB influence on topoisomerase activity

  • Perform linking number analysis before and after CrcB treatment

These approaches should be used in combination to build a comprehensive understanding of how CrcB modifies DNA topology and potentially influences recombination processes.

How does CrcB interact with homologous recombination pathways in E. coli?

The interaction between CrcB and homologous recombination (HR) pathways in E. coli remains incompletely characterized but can be understood through the lens of DNA topology regulation. HR in E. coli operates through two main presynaptic pathways: the RecBCD pathway and the RecFOR pathway, followed by the synaptic step mediated by RecA and postsynaptic processing involving RuvABC .

CrcB may influence these pathways through its effect on DNA topology. Specifically:

  • Presynaptic influence: DNA topology affects the accessibility of DNA to recombination machinery. CrcB-mediated changes in supercoiling could potentially enhance or inhibit the loading of presynaptic proteins like RecFOR onto DNA .

  • RecA filament formation: The formation of RecA nucleoprotein filaments, critical for strand invasion, is influenced by DNA topology. CrcB's modulation of DNA structure may therefore impact the efficiency of the synaptic phase of recombination .

  • Holliday junction resolution: The resolution of recombination intermediates by RuvABC may be affected by topological constraints, potentially providing another point of intersection between CrcB function and HR pathway efficiency .

Experimental approaches to investigate these interactions should include genetic studies with crcB deletions in combination with mutations in key recombination genes (recA, recBCD, recFOR, ruvABC), followed by phenotypic analysis of recombination frequency and DNA damage sensitivity.

What methodologies are recommended for analyzing CrcB expression patterns under different growth conditions?

To comprehensively analyze CrcB expression patterns under varying growth conditions, researchers should implement a multi-faceted approach:

Transcriptional Analysis:

  • RT-qPCR: Design primers specific to crcB for quantitative measurement of transcript levels across conditions

  • RNA-Seq: Perform whole-transcriptome analysis to place crcB expression in context with global gene expression changes

  • Promoter Fusion Assays: Create transcriptional fusions of the crcB promoter with reporter genes (e.g., lacZ, gfp) to monitor promoter activity in real-time

Translational Analysis:

  • Western Blotting: Develop specific antibodies against CrcB or use epitope-tagged versions for protein level quantification

  • Mass Spectrometry: Implement targeted proteomics approaches like Selected Reaction Monitoring (SRM) for precise quantification

  • Fluorescent Protein Fusions: Create translational fusions to monitor protein localization and abundance simultaneously

Regulatory Analysis:

  • DNase I Footprinting: Identify transcription factor binding sites in the crcB promoter region

  • ChIP-seq: Map regulatory proteins that interact with the crcB promoter

  • EMSA: Verify specific protein-DNA interactions at the crcB promoter

When analyzing expression data, it's important to note that CrcB regulation may be complex. Evidence suggests that expression of DNA topology modulators can be influenced by multiple factors, including growth phase, osmolarity, and stress conditions . Additionally, researchers should be aware that in some E. coli genes, expression patterns show competing regulatory influences—for example, expression at high osmolarity may result from conflicting stimulatory and inhibitory signals (as seen with YbdG) .

How can researchers effectively purify functional recombinant CrcB for structural studies?

Purification of functional recombinant CrcB for structural studies requires carefully optimized protocols to maintain protein stability and activity. Based on successful approaches with similar E. coli proteins, the following methodological workflow is recommended:

Expression System Optimization:

  • Test multiple expression constructs with different affinity tags (His6, GST, MBP)

  • Compare expression in various E. coli strains (BL21(DE3), C41(DE3), Rosetta)

  • Optimize induction conditions (temperature, inducer concentration, duration)

Purification Protocol:

  • Cell lysis under gentle conditions (mild detergents or mechanical disruption)

  • Initial capture using affinity chromatography (IMAC for His-tagged constructs)

  • Secondary purification via ion exchange chromatography

  • Final polishing step using size exclusion chromatography

  • Buffer optimization to maintain stability (screen various pH, salt concentrations, additives)

Quality Control Assessments:

  • SDS-PAGE and Western blotting to verify purity and identity

  • Dynamic light scattering to assess homogeneity

  • Circular dichroism to confirm proper folding

  • Activity assays to verify functional integrity (DNA binding, topology modification)

Structural Study Preparation:

  • Concentration optimization to avoid aggregation

  • Cryoprotectant screening for X-ray crystallography

  • Buffer exchange into NMR-compatible conditions if applicable

  • Establish protein-specific storage conditions that maintain stability

Researchers should note that membrane-associated proteins often require specialized detergent conditions during purification. If CrcB shows membrane association properties, detergent screening would be an essential additional step in the purification workflow.

What are the optimal experimental controls when studying CrcB's effects on DNA topology?

When investigating CrcB's effects on DNA topology, rigorous experimental controls are essential to distinguish specific CrcB-mediated effects from other influences. The following control framework is recommended:

Negative Controls:

  • Vehicle control: Buffer-only treatments to account for handling effects

  • Inactive CrcB variant: A site-directed mutant of CrcB with impaired function

  • Irrelevant protein control: A similarly sized protein with no known DNA topology effects

Positive Controls:

  • Known topology modifiers: Include experiments with well-characterized proteins like gyrase or topoisomerase

  • Reference supercoiled DNA: Commercial preparations with defined superhelical density

System Controls:

  • Concentration gradient: Test multiple CrcB concentrations to establish dose-response relationships

  • Time-course experiments: Monitor topology changes over multiple time points

  • Temperature controls: Perform reactions at different temperatures to distinguish enzymatic from passive effects

Validation Controls:

  • Independent methodologies: Confirm findings using at least two distinct assay types

  • Substrate variation: Test CrcB activity on different DNA templates (varying size, sequence, initial topology)

  • In vivo correlation: Compare in vitro findings with in vivo topology measurements

How can researchers detect and quantify CrcB-mediated changes in bacterial recombination rates?

Detecting and quantifying CrcB-mediated effects on recombination requires sensitive methodologies that can measure recombination events accurately. Based on established approaches in recombination research, the following methods are recommended:

In Vivo Recombination Assays:

  • Conjugational Recombination:

    • Measure frequency of recombinants following Hfr × F- mating

    • Compare wild-type vs. CrcB-overexpressing or CrcB-deficient strains

    • Quantify integration of selectable markers at multiple genomic locations

  • Phage-Based Recombination:

    • Utilize λ phage recombination systems with selectable markers

    • Measure plaque formation rates as indicators of successful recombination

    • Compare frequencies between CrcB variant strains

  • Plasmid-Based Assays:

    • Employ two-plasmid systems with partially homologous sequences

    • Quantify recombinant formation using appropriate selection

    • Analyze recombination junctions by sequencing

Molecular Analysis of Recombination:

  • Sister Chromatid Exchange (SCE) Analysis:

    • Utilize BrdU incorporation followed by differential staining

    • Quantify SCE events microscopically

    • Compare frequencies between CrcB variant strains

  • Recombination Protein Foci:

    • Create fluorescent protein fusions with RecA or other recombination proteins

    • Measure focus formation frequency by fluorescence microscopy

    • Analyze dynamics and persistence of foci

  • DNA Break Repair Kinetics:

    • Induce DNA damage using controlled methods (e.g., UV, mitomycin C)

    • Monitor repair kinetics through Southern blotting or qPCR

    • Compare repair efficiency between CrcB variant strains

Interpretation Framework:

  • Always normalize recombination rates to account for differences in growth or viability

  • Consider the influence of CrcB on DNA topology as a potential mechanism

  • Analyze recombination in multiple genetic backgrounds (e.g., recA, recF, recB) to identify pathway-specific effects

When analyzing results, researchers should consider that modulation of DNA topology by CrcB may have indirect effects on multiple cellular processes beyond recombination, necessitating careful experimental design and data interpretation.

What bioinformatic approaches are most useful for analyzing CrcB homologs across bacterial species?

Comprehensive bioinformatic analysis of CrcB homologs requires a multi-faceted approach that integrates sequence, structure, and functional predictions. The following methodological framework is recommended:

Sequence-Based Analysis:

  • Homology Identification:

    • BLASTP searches against diverse bacterial genomes

    • Position-Specific Iterative BLAST (PSI-BLAST) for distant homolog detection

    • Hidden Markov Model (HMM) profiles for enhanced sensitivity

  • Multiple Sequence Alignment:

    • MAFFT for accurate alignment of divergent sequences

    • T-Coffee for integration of structural information

    • Manual refinement of alignments in ambiguous regions

  • Conservation Analysis:

    • WebLogo visualization to identify highly conserved residues

    • ConSurf for mapping conservation onto structural models

    • Evolutionary trace methods to identify functionally important sites

Structural Analysis:

  • Structure Prediction:

    • AlphaFold2 or RoseTTAFold for ab initio modeling

    • Homology modeling based on available structures of related proteins

    • Quality assessment using MolProbity or ProQ

  • Functional Site Prediction:

    • Prediction of DNA-binding residues using specialized tools

    • Electrostatic surface mapping to identify potential interaction surfaces

    • Molecular dynamics simulations to identify flexible regions

Genomic Context Analysis:

  • Operonic Structure:

    • Analysis of genomic neighborhood across species

    • Identification of consistent gene associations

    • Operon prediction and verification

  • Regulatory Element Analysis:

    • Promoter region comparison across species

    • Identification of conserved regulatory motifs

    • Prediction of transcription factor binding sites

Comparative Genomics:

  • Phylogenetic profiling to correlate CrcB presence with specific traits

  • Assessment of horizontal gene transfer patterns

  • Analysis of selection pressure using dN/dS ratios

The integration of these approaches will provide a comprehensive understanding of CrcB evolution, conservation patterns, and potential functional roles across diverse bacterial species.

What are the common pitfalls in studying CrcB function, and how can researchers overcome them?

Research on CrcB presents several technical challenges that must be addressed for reliable results. Here are the major pitfalls and recommended solutions:

Expression and Purification Challenges:

ChallengeSolution
Low expression levelsOptimize codon usage; test multiple expression vectors; explore fusion tags like MBP or SUMO
Protein insolubilityScreen various detergents for membrane-associated fractions; test lower induction temperatures (16-20°C); use solubility-enhancing tags
Functional heterogeneityImplement rigorous quality control; separate active fractions using activity-based purification
Degradation during purificationInclude protease inhibitors; minimize purification time; identify and eliminate proteolytic hotspots

Functional Assay Challenges:

ChallengeSolution
Indirect effects on DNA topologyCompare wild-type to catalytically inactive mutants; use orthogonal assays to confirm results
Variability in in vivo resultsIncrease biological replicates; standardize growth conditions; use isogenic strains
Distinguishing direct from indirect effectsPerform in vitro reconstitution with purified components; use time-resolved assays
Background recombination activityCreate clean genetic backgrounds; include appropriate negative controls

Interpretation Challenges:

ChallengeSolution
Pleiotropic effects of CrcB manipulationUse conditional expression systems; employ targeted mutations affecting specific functions
Redundant functions with other proteinsGenerate multiple knockout combinations; perform complementation studies
Strain-specific differencesTest findings in multiple E. coli strains; standardize genetic backgrounds
Inconsistent phenotypesControl environmental variables rigorously; verify genotypes before each experiment

How can researchers resolve contradictory data regarding CrcB's role in DNA recombination?

When faced with contradictory data regarding CrcB's role in recombination, researchers should implement a systematic approach to resolve discrepancies:

Data Validation Framework:

  • Technical Verification:

    • Repeat experiments with standardized protocols across laboratories

    • Blind analysis of data to eliminate confirmation bias

    • Use multiple methodologies to measure the same phenomenon

  • Strain and Condition Documentation:

    • Maintain detailed records of strain backgrounds and precise genetic modifications

    • Document exact growth conditions, media composition, and environmental parameters

    • Create a standardized strain collection for cross-laboratory validation

  • Quantitative Analysis:

    • Implement statistical approaches appropriate for biological variability

    • Determine adequate sample sizes through power analysis

    • Use effect size calculations rather than just statistical significance

Resolving Specific Contradictions:

  • For conflicting genetic interaction data:

    • Construct clean deletion strains using scarless methods

    • Perform complementation tests with wild-type genes

    • Evaluate the impact of polar effects on neighboring genes

  • For inconsistent biochemical findings:

    • Characterize protein preparations by multiple quality control methods

    • Test activity across a range of conditions (pH, salt, temperature)

    • Consider post-translational modifications or alternative isoforms

  • For divergent in vivo observations:

    • Control for growth phase effects (early log, mid-log, stationary)

    • Standardize stress conditions and exposure times

    • Account for media-dependent effects on gene expression

Integration Approaches:

  • Construct testable models that could explain seemingly contradictory observations

  • Identify conditional factors that might cause context-dependent functions

  • Consider combinatorial effects with other cellular components

Establishing a community-wide framework for standardized reporting of experimental conditions, strain information, and methodological details will facilitate comparison across studies and help resolve contradictions in the literature.

What specialized equipment and reagents are necessary for comprehensive analysis of CrcB function?

A comprehensive analysis of CrcB function requires specialized equipment and reagents spanning multiple experimental approaches. The following resources are essential:

Equipment Requirements:

CategoryEssential EquipmentApplication
Protein AnalysisFPLC/HPLC systemProtein purification with multiple chromatography options
Circular dichroism spectrometerSecondary structure analysis and stability assessment
Dynamic light scatteringHomogeneity and aggregation analysis
DNA TopologyGel electrophoresis with circulationTwo-dimensional analysis of topoisomers
AFM or electron microscopyDirect visualization of DNA-protein complexes
Specialized microcentrifugeGradient separation of topoisomers
Recombination AssaysFluorescence microscopeVisualization of recombination foci
Flow cytometerHigh-throughput analysis of recombination reporters
Real-time PCR systemQuantification of recombination products
Structural StudiesX-ray diffractometer or NMRHigh-resolution structural analysis
Surface plasmon resonanceBinding kinetics measurement
Isothermal titration calorimetryThermodynamic analysis of interactions

Specialized Reagents:

  • DNA Topology Analysis:

    • Purified topoisomerases for control reactions

    • Specialized agarose for topoisomer separation

    • Chloroquine or ethidium bromide for topoisomer visualization

    • Defined supercoiled DNA standards

  • Recombination Studies:

    • Engineered substrate plasmids with selection markers

    • Purified recombination proteins (RecA, RecBCD, etc.)

    • DNA damage-inducing agents (mitomycin C, UV sources)

    • Specialized media for recombinant selection

  • Protein Analysis:

    • Anti-CrcB antibodies or epitope tag antibodies

    • Fluorescently labeled DNA substrates

    • Site-specific probes for conformation analysis

    • Detergents for membrane protein extraction

  • Genetic Tools:

    • Lambda Red recombination system for genetic manipulation

    • CRISPR-Cas9 components for precise genome editing

    • Controlled expression vectors with various inducible promoters

    • Reporter gene constructs (gfp, lacZ) for expression studies

Investment in these specialized resources is necessary for generating high-quality, reproducible data on CrcB function in DNA topology modulation and its potential role in recombination processes.

What emerging technologies might advance our understanding of CrcB's role in DNA topology and recombination?

Several cutting-edge technologies show promise for elucidating CrcB's functions in unprecedented detail:

Advanced Imaging Technologies:

  • Cryo-electron microscopy: Enables visualization of CrcB-DNA complexes in near-native states without crystallization requirements

  • Super-resolution microscopy: Allows tracking of single CrcB molecules in living cells, revealing dynamic interactions with the chromosome

  • 4D nucleome mapping: Combines imaging with genomic approaches to track topology changes across the entire genome over time

Next-Generation Sequencing Applications:

  • ChIP-exo and CUT&RUN: Provides higher resolution mapping of CrcB binding sites than traditional ChIP-seq

  • Long-read sequencing: Enables direct detection of DNA topology changes across extended genomic regions

  • Hi-C and derivatives: Maps three-dimensional chromosome organization influenced by CrcB activity

Protein Engineering Approaches:

  • Optogenetic CrcB variants: Allows precise temporal control of CrcB activity using light stimulation

  • Split protein complementation: Enables visualization of CrcB interactions with partner proteins in vivo

  • Proximity labeling (BioID, APEX): Identifies the protein neighborhood of CrcB under various conditions

Computational and Systems Biology:

  • Molecular dynamics simulations: Models CrcB-DNA interactions at atomic resolution

  • Machine learning approaches: Predicts functional sites from sequence and structural data

  • Network analysis: Maps CrcB's position within the broader DNA maintenance interactome

Genome Engineering:

  • Base editors and prime editors: Creates precise CrcB variants without double-strand breaks

  • Massively parallel reporter assays: Tests thousands of CrcB variants simultaneously

  • Synthetic genomics approaches: Examines CrcB function in minimal genome contexts

These technologies, particularly when used in combination, have the potential to resolve outstanding questions about CrcB's molecular mechanism and physiological significance in DNA topology regulation and recombination processes.

How might understanding CrcB function contribute to advances in synthetic biology applications?

Understanding CrcB's role in DNA topology modulation offers several promising applications in synthetic biology:

Engineered DNA Topology Control:

  • Creation of synthetic gene circuits with topology-dependent regulation

  • Development of DNA scaffolds with controlled structural properties for nanobiotechnology

  • Engineering of artificial chromosomes with optimized topological domains for gene expression

Enhanced Recombination Systems:

  • Design of more efficient DNA assembly methods by manipulating local DNA topology

  • Creation of controlled recombination systems for genome editing applications

  • Development of topology-optimized substrates for in vitro recombination reactions

Strain Improvement Applications:

  • Engineering of industrial strains with enhanced genetic stability

  • Optimization of recombination rates for accelerated strain evolution

  • Creation of bacteria with improved DNA repair capabilities for harsh environments

Synthetic Cell Development:

  • Integration of CrcB-based topology control in minimal cell systems

  • Development of artificial chromosome maintenance systems

  • Creation of programmable DNA architecture in synthetic cells

Biosensor Applications:

  • Development of topology-sensitive reporter systems for environmental monitoring

  • Creation of whole-cell biosensors that detect DNA-damaging agents

  • Engineering of stress-responsive systems with improved sensitivity

The practical implementation of these applications will require:

  • Detailed characterization of CrcB's mechanism of action

  • Development of engineered CrcB variants with predictable effects on DNA topology

  • Creation of mathematical models predicting the effects of topology changes on synthetic circuits

  • Integration of CrcB function with other DNA-modifying enzymes in synthetic systems

As researchers gain deeper insights into how CrcB modulates DNA topology and influences recombination, new applications will emerge at the intersection of synthetic biology and DNA nanotechnology.

How does CrcB function relate to bacterial stress response mechanisms?

CrcB's role in modulating DNA topology positions it as a potential component of bacterial stress response networks. DNA topology changes are known to occur during various stress conditions, suggesting CrcB may function as part of an integrated stress adaptation mechanism:

Osmotic Stress Response:

  • DNA topology changes significantly during osmotic shock

  • Evidence suggests that expression of some topology modulators is responsive to osmolarity changes

  • CrcB may contribute to adaptation by facilitating DNA structural adjustments required for altered gene expression patterns

Oxidative Stress Response:

  • Oxidative damage to DNA requires repair mechanisms that involve recombination

  • DNA topology changes occur during oxidative stress

  • CrcB could modulate access of repair machinery to damaged sites by influencing local DNA structure

Nutritional Stress Response:

  • Starvation conditions trigger global changes in gene expression

  • DNA topology shifts accompany entry into stationary phase

  • CrcB may participate in reorganizing chromosome structure during adaptation to nutrient limitation

Integrated Stress Response Networks:

  • CrcB likely operates within a larger network of topology-modifying enzymes

  • Differential regulation of these enzymes creates a balanced system for topology management

  • CrcB may have specialized functions during specific stress conditions

The relationship between CrcB and stress response mechanisms represents an important area for future research, with potential implications for understanding bacterial adaptation to changing environments and host conditions.

What insights from research on CrcB might be applicable to understanding human DNA recombination disorders?

While CrcB is a bacterial protein, research on its role in DNA topology and recombination provides conceptual frameworks relevant to understanding human recombination disorders:

Mechanistic Parallels:

  • DNA topology modulation is crucial for recombination in both prokaryotes and eukaryotes

  • Insights into how CrcB affects bacterial recombination may reveal conserved topological requirements

  • Principles learned from bacterial systems can guide investigation of human recombination regulators

Disease Modeling Applications:

  • Bacterial systems with CrcB variants could serve as simplified models for testing hypotheses about topology-dependent recombination defects

  • High-throughput screening in bacterial systems might identify compounds that correct recombination deficiencies

  • Synthetic biology approaches in bacteria could test proposed mechanisms of human recombination disorders

Translational Research Potential:

  • Understanding how DNA topology affects recombination fidelity might inform strategies to reduce genomic instability in cancer

  • Discoveries about topology-recombination links could suggest new therapeutic targets for diseases with aberrant recombination

  • Methods developed to study CrcB-DNA interactions could be adapted to study human topology modulators

Specific Human Disorders with Conceptual Connections:

  • Bloom Syndrome (defect in BLM helicase affecting recombination)

  • Fanconi Anemia (defects in DNA crosslink repair involving recombination)

  • Hereditary breast and ovarian cancers (BRCA1/2 mutations affecting homologous recombination)

  • Ataxia telangiectasia (ATM deficiency affecting recombination regulation)

While direct application of CrcB research to human disease requires caution due to significant differences between prokaryotic and eukaryotic systems, the fundamental principles of how DNA topology influences recombination processes are likely to have broad relevance.

What strategies can overcome challenges in detecting low-abundance CrcB protein in native conditions?

Detection of low-abundance proteins like CrcB under native conditions presents significant technical challenges. The following comprehensive strategy can overcome these limitations:

Sample Enrichment Techniques:

  • Subcellular Fractionation:

    • Separate cellular compartments to concentrate CrcB in relevant fractions

    • Use gentle lysis methods to preserve native protein interactions

    • Optimize fractionation protocols specifically for DNA-associated proteins

  • Affinity-Based Enrichment:

    • Develop highly specific antibodies against CrcB epitopes

    • Consider tagging endogenous CrcB using CRISPR-based approaches (maintaining native expression levels)

    • Implement DNA-based pulldown if CrcB has DNA-binding activity

  • Biochemical Enrichment:

    • Use salt or detergent gradients to separate protein complexes

    • Apply size-exclusion chromatography to isolate CrcB-containing complexes

    • Consider ion-exchange methods based on CrcB's predicted properties

Enhanced Detection Methods:

  • Targeted Mass Spectrometry:

    • Develop Selected Reaction Monitoring (SRM) or Parallel Reaction Monitoring (PRM) assays

    • Use synthetic peptide standards for absolute quantification

    • Implement AQUA (Absolute Quantification) peptides for precise measurement

  • Advanced Immunological Approaches:

    • Use signal amplification techniques (tyramide signal amplification, rolling circle amplification)

    • Develop proximity ligation assays for increased sensitivity

    • Consider multiplexed detection systems to simultaneously track CrcB and interaction partners

  • Specialized Microscopy:

    • Implement single-molecule detection methods

    • Use lattice light-sheet microscopy for improved signal-to-noise ratio

    • Apply deconvolution algorithms to enhance detection sensitivity

Experimental Design Considerations:

  • Induced Expression Conditions:

    • Identify conditions that naturally upregulate CrcB (potentially stress conditions)

    • Create reference samples with controlled overexpression for method validation

    • Develop a standard curve for quantification under different expression levels

  • Negative Controls:

    • Include crcB knockout strains as true negative controls

    • Process identical samples lacking the detection reagent (antibody, etc.)

    • Consider competition assays to verify signal specificity

  • Signal Validation:

    • Verify signals using multiple, independent detection methods

    • Perform genetic complementation to confirm signal restoration

    • Use orthogonal approaches to validate detected interactions or localizations

By implementing this multi-faceted approach, researchers can overcome the significant challenges in detecting and characterizing native CrcB protein even when present at low abundance.

What resources should researchers consult when beginning work with CrcB and E. coli recombination systems?

Researchers entering the field of CrcB and E. coli recombination studies should utilize a strategic combination of resources:

Foundational Literature:

  • Primary Research Articles:

    • Classic papers on E. coli recombination pathways and proteins

    • Recent publications characterizing CrcB function and regulation

    • Articles describing DNA topology modulation in bacteria

  • Review Articles:

    • Comprehensive reviews on homologous recombination in E. coli

    • Reviews on bacterial DNA topology and its regulation

    • Articles discussing the relationship between recombination and DNA repair

  • Methods Papers:

    • Protocols for recombination assays in E. coli

    • Techniques for DNA topology analysis

    • Approaches for protein-DNA interaction studies

Online Resources and Databases:

  • Sequence and Structure Resources:

    • RegulonDB for E. coli gene regulation information

    • UniProt and NCBI databases for protein sequence analysis

    • Protein Data Bank (PDB) for structural information

  • Bioinformatic Tools:

    • BLASTP and MAFFT for sequence analysis

    • WebLogo for conservation analysis

    • Structure prediction servers for modeling

  • E. coli Resources:

    • Coli Genetic Stock Center (CGSC) for strain resources

    • EcoCyc for metabolic and regulatory information

    • Colibri Web Server for E. coli sequences

Training Opportunities:

  • Laboratory Techniques:

    • Workshops on bacterial genetic manipulation

    • Courses on protein biochemistry and purification

    • Training in microscopy and imaging of bacterial cells

  • Computational Methods:

    • Bioinformatics courses focused on sequence analysis

    • Programming courses for data analysis (R, Python)

    • Workshops on structural bioinformatics

  • Experimental Design and Analysis:

    • Courses on statistical analysis of biological data

    • Training in designing genetic screens

    • Workshops on biochemical assay development

Community Resources:

  • Research Communities:

    • Microbial genetics research groups

    • DNA repair and recombination networks

    • Synthetic biology communities for application development

  • Collaborative Opportunities:

    • Core facilities for specialized techniques

    • Multi-lab initiatives studying recombination systems

    • Industry partnerships for application development

Beginning researchers should start with foundational reviews to understand the broader context before delving into specialized literature on CrcB function and experimental methodologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.