Recombinant Escherichia coli O81 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Catalytic Mechanism

GlpG employs a serine protease mechanism:

  1. Nucleophilic attack: S201 activates a water molecule for hydrolysis of peptide bonds .

  2. Transition state stabilization: H254 acts as a general base, while oxyanion hole residues stabilize the tetrahedral intermediate .

  3. Inhibitor studies: 3,4-dichloroisocoumarin and DFP covalently modify S201, confirming its essential role .

Activity-based profiling using fluorophosphonate probes demonstrates that residues outside the transmembrane core (e.g., Arg227) maintain catalytic competence by influencing active-site geometry .

Substrate Specificity and Cleavage

GlpG cleaves transmembrane substrates with:

  • Recognition motifs: Helix-destabilizing residues (e.g., glycine, proline) in substrate transmembrane domains .

  • Cleavage site preference: Hydrophilic regions near transmembrane segments, such as the Ser-Asp bond in model substrates .

Notable substrates include:

  • HybA: A subunit of the E. coli hydrogenase-2 complex, cleaved at Gly296 .

  • LacY-derived constructs: Engineered substrates used to study cleavage kinetics in vitro .

Recombinant Expression and Purification

Recombinant GlpG is produced in E. coli with an N-terminal His tag (Table 2), enabling affinity purification . Key characteristics include:

  • Molecular weight: ~32 kDa (1-276 amino acids).

  • Activity: Higher proteolytic efficiency compared to native GlpG in E. coli membranes .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in your order notes, and we will make every effort to fulfill your needs.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize developing it for you.
Synonyms
glpG; ECED1_4084; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLGNPA DPRYLAASWQSGHTDSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhomboid protease GlpG and what is its biological significance?

Rhomboid protease GlpG is an intramembrane serine protease that hydrolyzes substrate peptide bonds within the lipid bilayer. It serves as the prototype model system for studying the rhomboid family of proteases, which are important for a wide range of biological processes . GlpG from Escherichia coli has been identified as playing a crucial role in membrane protein quality control, specifically targeting components of respiratory complexes . Recently, HybA was identified as a physiological substrate of GlpG in Shigella sonnei, which shares 99% sequence identity with E. coli GlpG . The enzyme contains a catalytic domain embedded within the membrane with a distinctive architecture that allows it to conduct proteolysis within the hydrophobic environment of the lipid bilayer.

What are the key structural features of GlpG essential for its function?

The structure of GlpG includes multiple transmembrane helices that form the core catalytic domain. Key structural elements include:

  • A catalytic cavity containing the active site serine residue

  • The presence of water molecules within the catalytic cavity (confirmed by proton-detected solid-state NMR experiments)

  • A gating helix (TM5) with a previously unobserved kink in its central part

  • A dynamic region at the N-terminal part of TM5 and the adjacent loop L4, critical for substrate gating

  • A lateral gate formed by TM2 and TM5 that has been proposed to open and allow substrate entry

These structural features create a unique environment that enables GlpG to perform proteolysis within the membrane, with special mechanisms to allow substrate access and water entry to the catalytic site.

How can researchers distinguish between the different conformational states of GlpG?

Researchers can utilize several techniques to distinguish between different conformational states:

  • Relaxation dispersion experiments using solid-state NMR spectroscopy can detect conformational exchange between open and closed conformations of TM5

  • Secondary chemical shift analysis can reveal structural details such as the kink in the gating helix

  • Crystal structures obtained with inhibitors like diisopropyl fluorophosphonate (DFP) can provide insights into the tetrahedral transitional state and reveal conformational changes within the active site

  • Dynamics measurements can identify "dynamic hotspots" such as the N-terminal part of TM5 and loop L4, which are important for gating

When analyzing conformational states, researchers should consider that crystallographic data in detergent micelles may not fully represent the native membrane environment, as demonstrated by the differences observed between crystal structures and solid-state NMR data in lipid bilayers .

What are the optimal expression and purification methods for recombinant GlpG?

Based on established protocols, researchers should consider the following approaches:

  • Expression system: Escherichia coli BL21(DE3) has been successfully used as a host strain for recombinant protein production

  • Purification strategy: For crystallization studies, researchers have used a multi-step purification process that yields enzymatically active GlpG

  • Storage conditions: Purified GlpG can be stored in Tris-based buffer with 50% glycerol at -20°C, with extended storage at -80°C. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week

A critical consideration is ensuring the protein maintains its native fold and activity. When using tagged versions of the protein, researchers should verify that the tag (commonly His-tag) does not interfere with protein function or structure.

How can researchers effectively study GlpG in native-like membrane environments?

Studying GlpG in native-like membrane environments is crucial for understanding its physiological behavior. Several approaches have proven effective:

  • Solid-state NMR spectroscopy: This technique allows for the investigation of enzymatically active GlpG in lipid bilayers, providing insights into structure and dynamics under native-like conditions

  • Reconstitution into liposomes: By incorporating purified GlpG into liposomes of defined lipid composition, researchers can study the effects of membrane environment on enzyme activity

  • Nanodiscs: These provide a disc-like phospholipid bilayer stabilized by membrane scaffold proteins, offering a defined system for studying membrane proteins

When comparing results from different membrane mimetics, researchers should be aware that detergent micelles (often used for crystallization) may not accurately represent the native membrane environment. The solid-state NMR spectroscopy approach has revealed previously unobserved structural features, such as the kink in TM5, that were not apparent in crystal structures .

What approaches are recommended for assessing GlpG enzymatic activity?

Several methodological approaches can be employed to assess GlpG's enzymatic activity:

  • Substrate cleavage assays: Using known substrates such as HybA to measure proteolytic activity

  • Inhibitor studies: Employing inhibitors like diisopropyl fluorophosphonate (DFP) to probe the catalytic mechanism and active site structure

  • Activity in different lipid environments: Comparing activity across different membrane compositions to understand environmental effects on catalysis

When designing activity assays, researchers should consider:

  • The need for appropriate controls to account for spontaneous substrate degradation

  • The impact of detergents or lipid composition on enzyme activity

  • The potential effects of protein tags on catalytic efficiency

What are the current models for substrate gating in GlpG and how do they differ?

Two principal models have been proposed for substrate gating in GlpG:

  • Lateral gate model: Proposed by researchers based on crystallographic work, this model suggests that TM2 and TM5 form a lateral gate that opens to allow substrate entry from the side of the protein . In this model, TM5 and loop L5 can adopt either an "open" or "closed" conformation.

  • Top entry model: Proposed by Xue and Ha, this model suggests that substrates enter from the top rather than laterally . The substrate doesn't fully enter the enzyme but bends over to reach into the active site. This model requires only slight displacement of TM5, while loop L5 primarily influences substrate processing by acting as a cap.

Researchers have questioned whether the extreme bending of TM5 observed in some crystal structures might be an artifact of crystal packing rather than representing a physiological state . Solid-state NMR studies in lipid bilayers have revealed a dynamic hotspot at the N-terminal part of TM5 and loop L4, supporting the importance of this region in gating . Additionally, relaxation dispersion experiments suggest TM5 undergoes conformational exchange between open and closed states .

Both models likely include elements of exosite binding, where the substrate interacts with residues on TM2 and TM5 for recognition and positioning before undergoing helix unwinding and active site binding .

How do water molecules access and function in the catalytic cavity of GlpG?

The presence of water molecules in the catalytic cavity of GlpG is critical for its function as a serine protease, as water is required for the hydrolysis reaction. Research has provided several insights:

  • Proton-detected solid-state NMR experiments have confirmed the presence of water molecules in the catalytic cavity

  • The enzyme must maintain a delicate balance—allowing water access to the catalytic site while preventing unregulated water influx that could destabilize the membrane

  • Structural studies suggest that conserved residues form a pathway that allows controlled water access while maintaining the integrity of the membrane environment

Understanding this water accessibility is particularly important because traditional serine proteases operate in aqueous environments, while GlpG must function within the hydrophobic membrane bilayer. The presence of water in the catalytic site demonstrates how the enzyme creates a microenvironment that enables hydrolysis reactions within the membrane.

What structural and dynamic features distinguish GlpG from other intramembrane proteases?

GlpG has several distinctive features that differentiate it from other intramembrane proteases:

  • Catalytic mechanism: GlpG employs a serine protease mechanism (unlike metalloproteases or aspartyl proteases)

  • Gating dynamics: The enzyme exhibits specific dynamics at TM5 and loop L4 that are critical for substrate access

  • Water accessibility: Despite being membrane-embedded, GlpG maintains a water-accessible catalytic site

  • Conformational flexibility: NMR studies reveal that TM5 undergoes conformational exchange between open and closed states

These distinctive features allow GlpG to function effectively within the membrane environment while maintaining the essential catalytic capabilities of a serine protease. Understanding these differences helps researchers develop specific approaches for studying rhomboid proteases versus other classes of intramembrane proteases.

How can solid-state NMR spectroscopy enhance our understanding of GlpG structure and function?

Solid-state NMR spectroscopy has proven invaluable for studying GlpG in native-like lipid environments, offering several advantages:

  • Native environment analysis: Unlike X-ray crystallography, which typically requires detergent solubilization, solid-state NMR allows for the study of GlpG in lipid bilayers, providing insights into its structure and dynamics in a more physiologically relevant environment

  • Dynamic insights: NMR techniques can reveal dynamic processes critical to enzyme function, such as:

    • Conformational exchange between open and closed states of TM5

    • Identification of dynamic hotspots at the N-terminal part of TM5 and loop L4

  • Structural details: Secondary chemical shift analysis from NMR data has revealed previously unobserved structural features, such as a kink in the central part of the gating helix TM5

  • Water detection: Proton-detected experiments have confirmed the presence of water molecules in the catalytic cavity, providing evidence for how hydrolysis can occur within the membrane environment

Researchers employing solid-state NMR should consider complementing their studies with computational approaches and other experimental techniques to build a comprehensive understanding of GlpG function.

What crystallization techniques are most effective for structural studies of GlpG?

Successful crystallization of GlpG for structural studies has been achieved using specific techniques:

  • Initial purification: Recombinant GlpG should be prepared and purified following established protocols before crystallization attempts

  • Crystallization conditions: Effective conditions include:

    • Using reservoir solution containing 100 millimolar BisTris propane (pH 7.0) and 3 molar NaCl

    • Careful handling of crystals to maintain integrity

  • Inhibitor soaking: For co-crystallization with inhibitors such as diisopropyl fluorophosphonate (DFP):

    • High inhibitor concentrations (~500 millimolar) are preferable to repeated soaking at low concentrations

    • Direct addition of liquid DFP to the protein crystal drop (e.g., 1 microliter of 5.7 molar DFP to a 10-microliter drop)

    • Incubation for approximately 5 days at room temperature

  • Cryoprotection: Crystals should be cryoprotected with 25% glycerol and flash-cooled in liquid nitrogen before data collection

These techniques have enabled researchers to obtain crystal structures that provide insights into the tetrahedral transitional state and conformational changes within the active site of GlpG .

How do different membrane environments affect GlpG structure and function?

The membrane environment significantly impacts GlpG structure and function, an important consideration for experimental design:

  • Structural differences: Studies comparing GlpG in detergent micelles versus lipid bilayers have revealed structural differences, suggesting that the membrane environment influences protein conformation

  • Dynamic behavior: The lipid environment affects the dynamic properties of GlpG, particularly in regions critical for substrate gating like TM5 and loop L4

  • Catalytic activity: The composition of the membrane can influence:

    • Enzyme stability

    • Substrate accessibility

    • Catalytic efficiency

When designing experiments, researchers should carefully consider which membrane mimetic system best suits their research questions. Crystal structures obtained in detergent micelles provide high-resolution structural information but may not capture all aspects of the enzyme's behavior in native membranes. Conversely, studies in lipid bilayers offer insights into dynamics and function in a more native-like environment but may provide lower resolution structural data.

What are the known physiological substrates of E. coli GlpG and how were they identified?

Recent advances have identified physiological substrates of E. coli GlpG:

  • HybA as a substrate: In 2020, HybA was identified as a physiological substrate of GlpG in Shigella sonnei, which shares 99% sequence identity with E. coli GlpG

  • Functional significance: GlpG appears to be involved in membrane protein quality control, specifically targeting components of respiratory complexes

The identification of these substrates has provided critical insights into the biological role of GlpG. Future research directions may include:

  • Comprehensive substrate profiling to identify additional targets

  • Characterization of recognition motifs that determine substrate specificity

  • Investigation of how GlpG activity is regulated in response to cellular conditions

Understanding the physiological substrates is essential for contextualizing biochemical and structural studies within the broader biological functions of this enzyme.

What are the current challenges in developing specific inhibitors for rhomboid proteases like GlpG?

Developing specific inhibitors for rhomboid proteases presents several challenges:

  • Selectivity issues: Designing inhibitors that target rhomboid proteases without affecting other serine proteases requires detailed understanding of unique structural features

  • Membrane permeability: Effective inhibitors must reach the active site within the membrane environment, requiring appropriate physicochemical properties

  • Structure-based design: Crystal structures with inhibitors, such as the GlpG-diisopropyl fluorophosphonate complex, provide templates for rational design approaches

Current research has utilized inhibitors like diisopropyl fluorophosphonate to probe the catalytic mechanism and active site structure of GlpG . These studies provide models for the tetrahedral transitional state and reveal conformational changes within the active site.

Future inhibitor development may focus on exploiting the unique gating mechanism involving TM5 and loop L4, potentially targeting these regions to stabilize closed conformations of the enzyme.

How might understanding GlpG inform therapeutic approaches for human rhomboid-related proteins?

The insights gained from studying E. coli GlpG have significant implications for understanding human rhomboid-related proteins:

  • Conserved mechanisms: Many mechanistic features of GlpG are likely conserved in human rhomboid proteases, making it a valuable model system

  • Disease relevance: Human rhomboid proteases and pseudoproteases are implicated in various diseases, including:

    • Parkinson's disease

    • Cancer

    • Parasitic infections

  • Therapeutic potential: Understanding GlpG's catalytic mechanism, substrate recognition, and gating dynamics provides a foundation for developing:

    • Inhibitors of human rhomboid proteases for therapeutic applications

    • Engineered rhomboid proteases with modified specificity

    • Diagnostic tools based on rhomboid activity or inhibition

As research continues to elucidate the structure-function relationships of GlpG, these insights will inform approaches to modulating the activity of human rhomboid proteases for therapeutic benefit.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.