Recombinant Escherichia coli O81 Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Regulatory Networks Governing uspB Expression

uspB expression is tightly regulated by sigma factors and nucleoid-associated proteins:

  • Sigma S (RpoS): Essential for stationary-phase induction, as uspB transcription relies on σS-dependent promoters .

  • H-NS: Acts as a repressor, modulating σS activity to fine-tune uspB expression under stress .

  • Environmental Triggers: Ethanol exposure, nutrient depletion, and urea stress enhance uspB production .

Key Regulatory Interactions

RegulatorRoleSource
RpoSActivates uspB transcription in stationary phase
H-NSRepresses uspB expression through chromatin organization
Aromatic amino acidsIndirectly influence uspB via TyrR-mediated repression of competing pathways

Functional Roles in Stress Adaptation

uspB contributes to bacterial survival under diverse stress conditions:

  • Ethanol Resistance: Mutants lacking uspB exhibit heightened sensitivity to ethanol during stationary phase .

  • Membrane Integrity: Predicted role in modulating membrane composition to counteract osmotic or chemical stress .

  • Stress Cross-Protection: Overexpression of uspB correlates with enhanced tolerance to oxidative stress and nutrient starvation .

Experimental Insights

ConditionEffect on uspB ExpressionFunctional Outcome
Ethanol exposureProtection against toxicity
Nutrient depletionSurvival in stationary phase
Oxidative stressMembrane stabilization

Recombinant Production and Experimental Applications

Recombinant uspB is produced in heterologous systems (e.g., E. coli) for structural and functional analysis:

  • Expression Hosts: E. coli BL21(DE3) or similar strains optimized for disulfide bond formation .

  • Purification: His-tagged proteins are purified via immobilized metal affinity chromatography (IMAC) .

  • Quality Control: SDS-PAGE confirms >90% purity, with lyophilization for long-term storage .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uspB; ECED1_4163; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Universal Stress Protein B (uspB) and how does it function in E. coli?

Universal Stress Protein B (uspB) is part of the diverse USP family found in bacteria, archaea, plants, and metazoans. In E. coli, uspB plays a crucial role in cellular responses to various environmental stressors. USPs are significantly overexpressed under unfavorable conditions including nutrient starvation (deficiency of carbon, nitrogen, phosphate, sulfate, and amino acids), temperature shock, oxidative stress, heavy metal exposure, and antibiotic treatments . The physiological functions of USPs involve ion scavenging, hypoxia response, cellular mobility, and regulation of cell growth and development, particularly during periods of environmental stress .

What are the optimal conditions for recombinant expression of uspB in laboratory settings?

For recombinant expression of uspB in E. coli, researchers can employ several induction methods, with the cold-shock inducible system being particularly relevant for stress proteins:

Table 1: Comparison of Expression Methods for Recombinant Proteins in E. coli

MethodCulture ConditionsTemperatureIPTG ConcentrationIncubation TimeAdvantages
Conventional InductionGrow at 37°C until OD600 0.5-2.4Shift to 15°C for 30 min prior to induction, maintain at 15°C0.5 mM24 hoursGood for potentially toxic proteins
Short-InductionGrow at 37°C until OD600 0.5-2.4Vary between 15-37°C for 30 min, then maintain at 37°C0.01-1.0 mM24 hoursHigher protein yield for stable proteins
Pre-InductionGrow at 37°C until OD600 0.5Decrease to 15°C during induction0.5 mM24 hours initial, then transfer to fresh mediaAllows for controlled expression phases

For optimal expression of His-tagged uspB, the use of E. coli BL21(DE3) as a host strain with induction using 0.5 mM IPTG for 20 hours at 18°C with shaking in 2YT media has proven effective for recombinant stress proteins .

What purification strategies yield high-purity recombinant uspB protein?

An effective purification protocol for His-tagged uspB involves the following steps:

  • Harvest cells by centrifugation after induction

  • Resuspend cell pellets in lysis buffer containing:

    • 20 mM sodium phosphate dibasic

    • 500 mM sodium chloride

    • 30 mM imidazole

    • Protease inhibitors (1 μL/g aprotinin and 1 mM PMSF)

  • Lyse cells via sonication (10s pulses at 50% amplitude, while keeping samples cold)

  • Clarify lysate by centrifugation at high speed or filtration through progressively smaller pore sizes

  • Purify using immobilized metal affinity chromatography (IMAC)

For storage, the purified uspB protein can be maintained in Tris-based buffer with 50% glycerol. It is recommended to store at -20°C for regular use, or at -80°C for extended storage. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

How does uspB contribute to E. coli's stress response mechanisms?

The primary function of uspB appears to be related to cellular adaptation during stress conditions. While the specific function of uspB has not been fully characterized, studies on other USP family members provide insights into potential roles. USPs in E. coli are generally associated with:

  • Cellular growth arrest in response to prolonged stress

  • Protection against oxidative damage

  • Survival during nutrient limitation

  • Adaptation to temperature fluctuations

  • Resistance to antibiotics and toxic compounds

In contrast to some other bacterial species where USP deletion significantly reduces survival under stress conditions, the specific contribution of uspB to E. coli's stress response network appears to be part of a coordinated system involving multiple USP paralogs .

What distinguishes uspB from other USP family proteins in E. coli?

E. coli possesses multiple USP paralogs, including UspA, UspC, UspD, UspE, UspF, and UspG, which function in a coordinated manner to enhance stress tolerance. The distinct roles of these paralogs have been characterized:

Table 2: Functional Differentiation of USP Proteins in E. coli

USP ProteinDomain StructurePrimary FunctionsStress Response
UspBSingle USP domainLess characterizedLikely involved in membrane-associated stress response
UspASingle USP domainGrowth arrest in response to stressReduced survival in uspA-mutated strains under stress
UspCSingle USP domainCell adhesion, agglutination, motilityOxidative stress response
UspDSingle USP domainInvolved in iron homeostasisIncreased sensitivity to streptonigrin in uspD mutants
UspETwo USP domainsSimilar to UspCOxidative stress response
UspFSingle USP domainNegative regulation of mobility, positive control of cell attachmentDifferent function from UspC/E in cellular migration
UspGSingle USP domainSimilar to UspFSimilar to UspF in cellular migration

These functional differences highlight the specialized roles that different USP proteins play in the bacterial stress response network .

How is uspB expression regulated at the genomic level?

The regulation of uspB expression involves a complex interplay of transcriptional control elements. Research has revealed that in both E. coli and Salmonella bongori, the divergent TyrR-regulated P3 promoter of the aroP gene drives usp expression . The aroP gene encodes an aromatic amino acid membrane transporter, suggesting a potential link between amino acid metabolism and stress response.

Several key regulatory factors influence uspB expression:

  • TyrR regulatory network: The uspB gene has integrated into this network, suggesting evolutionary adaptation

  • H-NS (histone-like nucleoid structuring protein): Acts as a repressor of uspB expression

  • Environmental factors that induce expression include:

    • Aromatic amino acids

    • Temperature fluctuations

    • Urea concentration changes

This regulatory pattern indicates that uspB expression responds to both specific metabolic cues and general stress conditions.

What approaches can be used to analyze uspB transcription and translation during stress responses?

Several experimental approaches can be employed to monitor uspB expression:

  • Reporter Gene Assays: Construction of uspB promoter-reporter fusions (such as uspB-CAT) allows for quantitative analysis of promoter activity under different conditions. The promoter region can be PCR-amplified and cloned into appropriate vectors .

  • Real-time PCR: For quantifying uspB transcript levels during different stress conditions. This approach has been used to analyze USP gene expression in various bacterial systems .

  • Immunoblotting: Using anti-uspB antibodies to detect protein levels. For unknown USPs, generation of antibodies against recombinant proteins with appropriate tags can be employed .

  • Transcript Stability Analysis: To determine mRNA half-life, which can be particularly important as some bacterial USP transcripts show unusual stability (over 30 minutes in some cases) .

  • Comparative Expression Analysis: Using wild-type and usp-deleted mutants exposed to various stress conditions to understand regulation patterns .

How can recombinant uspB be used as a tool for studying bacterial stress responses?

Recombinant uspB offers several research applications for investigating bacterial stress responses:

  • Structural Studies: Purified recombinant uspB can be used for crystallographic or NMR studies to determine its three-dimensional structure and understand the molecular basis of its function.

  • Protein Interaction Studies: Tagged recombinant uspB can help identify protein-protein interactions through pull-down assays, co-immunoprecipitation, or yeast two-hybrid screenings, revealing its role in stress response networks.

  • Functional Complementation: Recombinant uspB can be used to complement uspB-deficient bacterial strains to verify its specific functions under various stress conditions.

  • Antibody Production: Recombinant uspB can serve as an antigen for generating specific antibodies, which are valuable tools for detecting endogenous uspB levels in different bacterial strains and under various stress conditions .

  • In vitro Biochemical Assays: Purified recombinant uspB can be used to investigate potential enzymatic activities or other biochemical properties related to stress response mechanisms.

What experimental controls should be included when studying uspB function in stress response?

When designing experiments to investigate uspB function, several key controls should be incorporated:

  • Wild-type vs. Deletion Mutant Comparisons: Creating a markerless, in-frame uspB deletion mutant (ΔuspB) to compare with wild-type strains under various stress conditions. This approach has proven valuable in studies of other USP proteins .

  • Complementation Controls: Reintroducing the uspB gene into deletion mutants to confirm that observed phenotypes are specifically due to uspB absence.

  • Multiple Stress Conditions: Testing responses to diverse stressors, including:

    • Oxidative stress (hydrogen peroxide, paraquat)

    • pH stress (acidic conditions)

    • Nutrient limitation

    • Temperature stress

    • Stationary phase survival

  • Time-course Analyses: Monitoring changes in uspB expression and bacterial survival over time to capture both immediate and long-term stress responses.

  • Cross-species Comparisons: Comparing uspB function across different bacterial species to understand conserved and divergent aspects of USP function .

How do post-translational modifications affect uspB function in stress conditions?

Post-translational modifications (PTMs) potentially play significant roles in regulating uspB function under stress conditions, though specific modifications of uspB are not well characterized in the provided research. Studies with other bacterial USPs have shown that:

  • Some USPs undergo phosphorylation, which can alter their activity or interactions with other proteins

  • USPs may experience redox-dependent modifications, particularly relevant during oxidative stress

  • In some cases, USPs have been found to be post-translationally modified when recombinantly expressed in E. coli

Research approaches to investigate PTMs include:

  • Mass spectrometry analysis of purified uspB to identify modification sites

  • Site-directed mutagenesis of potential modification sites to assess functional consequences

  • Comparisons of uspB modifications under different stress conditions

What are the molecular mechanisms by which uspB protects against specific stressors?

The detailed molecular mechanisms underlying uspB's protective functions remain to be fully elucidated, but several potential mechanisms can be inferred from studies of related USPs:

  • Transcriptional Regulation: USPs can contribute to enhanced expression of stress defense genes. For example, in F. tularensis, USP enhances the expression of antioxidant defense genes like oxyR and katG .

  • Protein Stabilization: USPs may function as chaperones or co-chaperones to prevent denaturation of essential proteins during stress conditions.

  • Metabolic Adaptation: USPs can influence metabolic pathways to adapt to changing environmental conditions, particularly during nutrient limitation.

  • Membrane Protection: Given uspB's sequence features, it may play a role in maintaining membrane integrity during stress conditions.

  • Anti-oxidative Functions: Some USPs directly or indirectly contribute to detoxification of reactive oxygen species, which is particularly relevant during oxidative stress .

To investigate these mechanisms, researchers should consider employing transcriptomic, proteomic, and metabolomic approaches to comprehensively assess the impact of uspB deletion or overexpression on cellular physiology under various stress conditions.

How conserved is uspB across different E. coli strains and related bacterial species?

Phylogenetic analyses of USP genes provide insights into their evolutionary relationships and functional significance. The uspA gene has been extensively studied in this context and shows high conservation among different E. coli isolates, with sequence identity as high as 99.25% across strains . While specific data for uspB conservation is limited in the provided research, the conservation pattern of USP family genes suggests important evolutionary selection pressure.

Research approaches for investigating uspB conservation include:

  • Comparative genomic analysis across E. coli strains and related Enterobacteriaceae

  • Phylogenetic tree construction based on uspB sequences

  • Analysis of synonymous and non-synonymous substitutions to detect selection signatures

  • Structural comparisons of uspB across different bacterial species

Understanding the conservation pattern can provide insights into the functional importance and evolutionary adaptations of uspB in different ecological niches.

What can bioinformatic analyses reveal about uspB structure-function relationships?

Bioinformatic approaches offer valuable insights into uspB structure-function relationships:

  • Homology Modeling: Using known USP structures as templates, homology models of uspB can be generated to predict its three-dimensional structure. This approach has been successful for other USPs, revealing conserved structural features like the β-sheet core typical of the USP family .

  • Sequence Conservation Analysis: Identification of highly conserved residues across uspB homologs can highlight functionally important amino acids.

  • Domain and Motif Prediction: Analysis of uspB sequence for functional domains, motifs, or catalytic sites that might explain its specific biochemical activities.

  • Molecular Dynamics Simulations: Computational simulations of uspB behavior under different conditions can provide insights into its functional mechanisms.

  • Epitope Prediction: Computational tools can identify potential B-cell epitopes in uspB, which could be valuable for antibody development or diagnostic applications .

These bioinformatic approaches, combined with experimental validation, can significantly advance our understanding of how uspB structure relates to its function in stress response.

What are the common challenges in working with recombinant uspB and how can they be addressed?

Researchers working with recombinant uspB may encounter several challenges:

  • Protein Solubility Issues: Stress proteins can sometimes form inclusion bodies when overexpressed. Solutions include:

    • Using fusion tags like TF (trigger factor) that enhance solubility

    • Optimizing expression temperature (typically lower temperatures improve solubility)

    • Employing solubility-enhancing additives in purification buffers

    • Utilizing specialized E. coli strains that enhance proper folding

  • Protein Stability Concerns: For storage and experimental manipulation, stability can be enhanced by:

    • Adding glycerol (50%) to storage buffers

    • Avoiding repeated freeze-thaw cycles

    • Preparing small working aliquots for regular use

    • Using appropriate protease inhibitors during purification

  • Functional Assay Development: Given the diverse functions of USPs, developing specific assays for uspB can be challenging. Approaches include:

    • Comparative survival assays under various stress conditions

    • Molecular interaction studies to identify binding partners

    • Enzymatic activity assays based on predicted functions

How can researchers effectively differentiate between the functions of uspB and other USP family members?

Distinguishing the specific functions of uspB from other USP family members requires carefully designed experimental approaches:

  • Gene-specific Knockout Studies: Creating single, double, and multiple USP gene knockouts to assess functional redundancy and specificity through phenotypic comparisons.

  • Complementation Experiments: Expressing different USPs in knockout strains to determine if they can functionally substitute for each other.

  • Domain Swapping: Constructing chimeric proteins with domains from different USPs to identify which domains confer specific functions.

  • Expression Pattern Analysis: Comparing the expression patterns of different USP genes under various stress conditions to identify condition-specific responses.

  • Protein Localization Studies: Determining the subcellular localization of different USPs, which may provide insights into their specific functions.

  • Protein-Protein Interaction Mapping: Identifying unique interaction partners for each USP family member using techniques like bacterial two-hybrid systems or co-immunoprecipitation followed by mass spectrometry.

These approaches collectively can help delineate the specific roles of uspB within the broader context of the USP family in E. coli stress response mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.