Recombinant Escherichia coli O81 UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate any specific format preferences you may have. Please indicate your desired format when placing your order and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us and we will prioritize its implementation.
Synonyms
mntP; yebN; ECED1_2024; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
mntP
Target Protein Sequence
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the YebN membrane protein and what is its function in E. coli?

YebN is a UPF0059 family membrane protein found in Escherichia coli O81 strains. While the specific function of YebN remains under investigation, it belongs to a class of integral membrane proteins that typically play roles in transport, signaling, or structural integrity of the bacterial cell membrane. As a membrane protein, YebN contains transmembrane domains that anchor it within the lipid bilayer of the bacterial membrane. Research suggests that UPF0059 family proteins may be involved in cellular processes requiring membrane integration, though specific functional characterization of YebN requires further experimental validation .

What expression systems are most effective for recombinant YebN production?

For recombinant YebN production, the E. coli expression system remains the most commonly utilized platform due to its simplicity, cost-effectiveness, and high protein yield. When expressing membrane proteins like YebN, specialized E. coli strains such as BL21(DE3) or JM109 have shown effectiveness for membrane protein expression. These strains have been successfully used for the expression of other membrane-associated proteins as demonstrated in the literature .

For optimal expression, consider the following approach:

  • Use low-copy number plasmids to avoid overwhelming the membrane insertion machinery

  • Employ tightly controlled promoters (such as T7 with lac operator) to regulate expression levels

  • Incorporate appropriate signal sequences if targeting specific membrane compartments

  • Grow cultures at reduced temperatures (16-25°C) after induction to allow proper folding and membrane insertion

How does the Sec pathway influence the expression and localization of recombinant YebN?

The Sec pathway plays a crucial role in the proper localization of membrane proteins like YebN. This pathway facilitates the translocation of unfolded proteins across the cytoplasmic membrane in a translocation-competent state. For membrane proteins like YebN, the Sec machinery recognizes the signal peptide and facilitates proper integration into the membrane.

Research has demonstrated that preproteins destined for the Sec pathway can be posttranslationally modified in the cytosol prior to translocation, and the Sec machinery can accommodate these modified proteins. This suggests that YebN could potentially be modified before membrane integration, which might be relevant for functional studies. The process involves:

  • Recognition of the signal peptide by SecB or SRP

  • Targeting to the SecYEG translocon

  • Transport of the unfolded protein through the channel

  • Integration into the membrane for transmembrane proteins like YebN

What are the optimal methods for purifying recombinant YebN protein while maintaining its native conformation?

Purification of membrane proteins like YebN requires specialized approaches to maintain their native conformation. A methodological workflow would include:

  • Membrane isolation: Harvest E. coli cells expressing YebN, resuspend in buffer (typically PBS), and disrupt cells using sonication or mechanical methods.

  • Solubilization: Extract membrane proteins using appropriate detergents that preserve protein structure:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

    • Use a detergent:protein ratio of 10:1 initially

    • Incubate for 1-2 hours at 4°C with gentle rotation

  • Affinity purification: If YebN is expressed with an affinity tag:

    • For His-tagged YebN, use Ni-NTA agarose chromatography

    • Include detergent in all wash and elution buffers

    • Use imidazole gradient elution (50-300 mM) for His-tagged proteins

  • Size exclusion chromatography: Further purify the protein by size:

    • Use columns suitable for membrane proteins (Superdex 200)

    • Maintain detergent concentration above critical micelle concentration

  • Quality assessment: Analyze purity using SDS-PAGE and confirm structural integrity through circular dichroism or limited proteolysis

How can biotinylation techniques be applied to study YebN topology and interactions?

Biotinylation is a valuable approach for studying membrane protein topology and interactions. For YebN research, cell surface biotinylation can specifically label exposed domains:

  • Cell surface biotinylation protocol:

    • Culture E. coli expressing YebN to mid-log phase

    • Wash cells with PBS to remove media components

    • Incubate with Sulfo-NHS-SS-Biotin (cell-impermeable reagent) for 10 minutes at room temperature

    • Quench the reaction with Tris-buffered saline (TBS)

    • Harvest cells by centrifugation at 500 x g for 3 minutes

  • Protein isolation and analysis:

    • Lyse cells in appropriate lysis buffer for 30 minutes on ice

    • Capture biotinylated proteins using NeutrAvidin agarose for 30 minutes

    • Wash extensively to remove non-specific binding

    • Elute with 10 mM DTT to cleave the disulfide bond in the biotin linker

    • Analyze by Western blotting or mass spectrometry

  • Topology mapping:

    • Compare biotinylation patterns under different permeabilization conditions

    • Extracellular domains will be labeled under non-permeabilizing conditions

    • Intracellular domains require cell permeabilization for labeling

What approaches can be used to assess YebN's post-translational modifications in recombinant systems?

Post-translational modifications (PTMs) of membrane proteins like YebN can be assessed using several complementary techniques:

  • Mass spectrometry-based approach:

    • Purify YebN using affinity chromatography

    • Perform in-gel or in-solution digestion with trypsin/Lys-C protease mix

    • Analyze peptides using LC-MS/MS on a high-resolution mass spectrometer (e.g., Q Exactive Plus Hybrid Quadrupole-Orbitrap)

    • Process data with Proteome Discoverer Software to identify PTMs

    • Compare experimental masses with theoretical masses to identify modifications

  • Western blot with modification-specific antibodies:

    • Separate proteins by SDS-PAGE and transfer to nitrocellulose

    • Block membranes with appropriate blocking buffer (e.g., StartingBlock T20)

    • Probe with antibodies specific to common PTMs (phosphorylation, glycosylation)

    • Develop using enhanced chemiluminescence detection

  • Specialized staining:

    • Pro-Q Diamond for phosphoproteins

    • Periodic acid-Schiff (PAS) staining for glycoproteins

    • Coomassie blue as a total protein control

How can fusion protein approaches enhance YebN study and potential applications?

Fusion protein strategies offer powerful tools for studying membrane proteins like YebN. Based on research with other E. coli membrane proteins, the following approaches can be applied:

  • N-terminal and C-terminal fusion options:

    • YebF-YebN fusions may facilitate secretion, as YebF has been demonstrated as an effective carrier protein for extracellular production

    • MBP-YebN fusions can enhance solubility and provide an affinity purification handle

    • GFP-YebN fusions enable real-time localization studies and folding assessment

  • Cleavable linker incorporation:

    • TEV protease recognition sites between YebN and fusion partners allow for tag removal

    • Design constructs with His-tags inserted between signal peptide and mature protein for purification

    • Optimize linker length (typically 3-5 glycine-serine repeats) to minimize steric hindrance

  • Functional domain mapping:

    • Create truncated versions of YebN fused to reporter proteins

    • Systematically delete transmembrane domains to determine essential regions

    • Employ domain swapping with related proteins to identify functional motifs

What experimental approaches can determine if YebN interacts with the Sec translocation machinery?

Investigating YebN interactions with the Sec machinery requires specialized techniques to capture these often transient protein-protein interactions:

  • In vivo crosslinking approach:

    • Treat E. coli expressing YebN with membrane-permeable crosslinkers (DSP or formaldehyde)

    • Lyse cells and immunoprecipitate using antibodies against Sec components (SecY, SecA)

    • Alternatively, use His-tagged YebN for pulldown experiments

    • Analyze by Western blotting or mass spectrometry to identify interaction partners

  • Site-specific photocrosslinking:

    • Incorporate photoreactive amino acid analogs (pBpa) at specific positions in YebN

    • Activate crosslinking with UV light during active protein translocation

    • Identify crosslinked products by immunoblotting or mass spectrometry

  • Sodium azide inhibition studies:

    • Sodium azide specifically inhibits SecA ATPase activity

    • Monitor YebN accumulation in cytosol after treatment with 1 mM sodium azide

    • Quantify by Western blotting or fluorescence if using GFP-fusion

    • Compare cytosolic accumulation patterns with known Sec-dependent proteins

How can advanced proteomics approaches be applied to characterize YebN in membrane protein complexes?

Advanced proteomics offers powerful tools for characterizing YebN and its potential interactions within membrane protein complexes:

  • Quantitative membrane proteomics workflow:

    • Isolate membrane fractions from E. coli expressing YebN

    • Solubilize with appropriate detergents or use lipid nanodiscs

    • Digest proteins using the EasyPep Mini MS Sample Prep Kit

    • Analyze using label-free quantification on a high-resolution mass spectrometer

    • Process data with Proteome Discoverer Software for protein identification and quantification

  • Blue native PAGE for complex identification:

    • Solubilize membranes with mild detergents to preserve protein complexes

    • Separate native complexes on gradient gels

    • Excise bands for second-dimension SDS-PAGE or direct MS analysis

    • Identify components of YebN-containing complexes

  • Proximity labeling approaches:

    • Create YebN fusions with promiscuous biotin ligases (BioID or TurboID)

    • Express in E. coli and provide biotin substrate

    • Capture biotinylated proximal proteins using NeutrAvidin resin

    • Identify interacting partners by mass spectrometry

    • Table 1 below summarizes typical yields from such enrichment approaches:

Cell LineMethodPeptide yield (µg)Cell Surface Proteins (%)Intracellular Contaminants (%)
E. coliNew10-1455-6040-45
E. coliOld90-9527-3070-73

Note: Values adapted from similar membrane protein isolation techniques

What methods are most effective for assessing YebN function in recombinant systems?

Determining the function of YebN requires multiple complementary approaches:

  • Phenotypic analysis of knockout and overexpression strains:

    • Create YebN deletion strains using CRISPR-Cas9 or traditional knockout methods

    • Develop controlled expression systems using inducible promoters

    • Assess growth under various stress conditions (pH, temperature, osmotic)

    • Measure membrane integrity using dye penetration assays

  • Transport assays if YebN functions as a transporter:

    • Reconstitute purified YebN in liposomes with appropriate fluorescent substrates

    • Monitor substrate accumulation or depletion over time

    • Test ion flux using specific indicators (calcium, pH, membrane potential)

    • Compare transport kinetics with known transporters

  • Interactome analysis:

    • Perform co-immunoprecipitation with YebN-specific antibodies

    • Use tandem affinity purification with tagged YebN

    • Identify interaction partners by mass spectrometry

    • Validate key interactions using bacterial two-hybrid assays

How can recombinant YebN be effectively labeled for structural and localization studies?

Several labeling strategies can be employed for YebN structural and localization studies:

  • Site-specific fluorescent labeling:

    • Introduce single cysteine residues at strategic positions in YebN

    • Label with thiol-reactive fluorophores (Alexa Fluor maleimides)

    • Confirm labeling efficiency by UV-visible spectroscopy

    • Use for FRET studies to measure distances between domains

  • Biotinylation approaches for topology studies:

    • Express YebN in intact E. coli cells

    • Apply cell-impermeable biotinylation reagent (Sulfo-NHS-SS-Biotin)

    • Extract and capture biotinylated proteins using NeutrAvidin agarose

    • Analyze labeled portions by mass spectrometry to determine exposed regions

  • Immunofluorescence microscopy:

    • Fix cells expressing epitope-tagged YebN

    • Permeabilize selectively to access specific cellular compartments

    • Label with primary antibodies against the tag

    • Visualize using fluorescent secondary antibodies

    • Compare localization patterns with known membrane markers

What are the challenges and solutions for scaling up recombinant YebN production for structural studies?

Scaling up YebN production for structural studies presents several challenges that can be addressed through optimized protocols:

  • Expression optimization:

    • Test multiple E. coli strains (BL21, C41/C43 - specialized for membrane proteins)

    • Screen induction conditions systematically (temperature, inducer concentration, time)

    • Consider auto-induction media to avoid toxicity of sudden overexpression

    • Co-express with chaperones to improve folding efficiency

  • Solubilization and stability enhancement:

    • Screen detergent panel for optimal extraction (DDM, LMNG, digitonin)

    • Add lipids during purification to stabilize the native structure

    • Use high-throughput thermal stability assays to identify optimal buffer conditions

    • Consider nanodiscs or amphipols for detergent-free environments

  • Purification scale-up challenges:

    • Implement tangential flow filtration for efficient cell concentration

    • Use larger chromatography columns with appropriate flow rates

    • Maintain consistent detergent concentrations throughout the process

    • Concentrate protein using specialized devices for detergent-containing samples

  • Quality control metrics:

    • Assess homogeneity by analytical size exclusion chromatography

    • Verify folding using circular dichroism spectroscopy

    • Evaluate oligomeric state by multi-angle light scattering

    • Perform preliminary negative-stain electron microscopy to confirm particle integrity

How can cryo-EM be applied to determine the structure of YebN and its complexes?

Cryo-electron microscopy (cryo-EM) offers advantages for membrane protein structural studies and can be applied to YebN research:

  • Sample preparation considerations:

    • Purify YebN to >95% homogeneity and confirm monodispersity

    • Test both detergent micelles and nanodiscs as membrane mimetics

    • Optimize protein concentration (typically 0.5-5 mg/ml)

    • Screen grid types and freezing conditions to minimize preferential orientation

  • Data collection strategy:

    • Collect on high-end microscopes (300kV Titan Krios with K3 detector)

    • Use beam-induced motion correction and CTF estimation

    • Implement dose-fractionation to minimize radiation damage

    • Collect sufficient particles (typically >500,000) for high-resolution reconstruction

  • Data processing workflow:

    • Perform 2D classification to eliminate poor particles

    • Use ab initio reconstruction for initial model generation

    • Apply non-uniform refinement to account for flexibility

    • Implement focused refinement on transmembrane regions

  • Validation approaches:

    • Assess resolution using gold-standard FSC criteria

    • Evaluate model-map correlation

    • Confirm topology using independent biochemical data

    • Perform mutagenesis of key residues identified in the structure

What innovative approaches can identify interaction partners and regulatory networks of YebN?

Advanced techniques can reveal YebN's interaction partners and regulatory networks:

  • Proximity-dependent labeling in living cells:

    • Create YebN fusions with TurboID or APEX2 enzymes

    • Express in native E. coli environment

    • Add biotin or biotin-phenol substrates for short labeling windows

    • Capture biotinylated proteins and identify by mass spectrometry

    • Quantify enrichment relative to controls to identify specific interactors

  • Genetic interaction mapping:

    • Perform synthetic genetic array (SGA) analysis with YebN deletion

    • Create double mutant libraries using CRISPR-Cas9 multiplexing

    • Identify genetic interactions through growth phenotype analysis

    • Construct interaction networks to reveal functional relationships

  • Transcriptional response profiling:

    • Compare RNA-seq data between wild-type and YebN knockout strains

    • Identify differentially expressed genes under various conditions

    • Perform ChIP-seq of transcription factors showing altered expression

    • Integrate data to build regulatory network models

  • Protein-protein interaction verification:

    • Confirm key interactions using multiple orthogonal methods

    • Apply bacterial two-hybrid or split-protein complementation assays

    • Validate direct interactions using purified components

    • Quantify binding affinities using microscale thermophoresis or bio-layer interferometry

How does post-translational modification affect YebN function and can it be manipulated in recombinant systems?

Post-translational modifications (PTMs) can significantly impact membrane protein function, and for YebN:

  • Identification of native PTMs:

    • Purify native YebN from E. coli membranes

    • Analyze by high-resolution mass spectrometry

    • Search for common bacterial PTMs (phosphorylation, methylation, acetylation)

    • Compare modification patterns under different growth conditions

  • Engineering specific modifications:

    • Co-express YebN with modification enzymes (kinases, transferases)

    • For phosphopantetheinylation, co-express with AcpS enzyme

    • For biotinylation, co-express with BirA enzyme

    • Verify modification using mass shift analysis or PTM-specific antibodies

  • Functional impact assessment:

    • Create YebN variants with mutation at modification sites

    • Express phosphomimetic mutants (Ser/Thr to Asp/Glu)

    • Compare activity of modified and unmodified forms

    • Perform structural analysis to determine how PTMs affect conformation

  • Temporal control of modification:

    • Use sodium azide to retard translocation and increase cytosolic modification

    • Implement inducible expression systems for modification enzymes

    • Engineer orthogonal enzyme-substrate pairs for specific targeting

    • Quantify modification stoichiometry under different conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.