Recombinant Escherichia coli O81 UPF0114 protein YqhA (yqhA) is a full-length recombinant protein derived from the yqhA gene (UniProt ID: B7MZZ0) in E. coli strain O81. It is expressed in E. coli with an N-terminal His tag for purification and structural studies. The protein spans 164 amino acids (MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH) .
The protein is produced via recombinant DNA technology using E. coli as the expression system. Key steps include:
Cloning: The yqhA gene is inserted into a plasmid vector under a T7 or lac promoter for inducible expression .
Expression: Induced with IPTG (isopropyl β-D-1-thiogalactopyranoside) or temperature shifts to optimize yield .
Purification: Affinity chromatography (via the His tag) followed by dialysis and lyophilization .
Multiple vendors provide this protein with slight variations in specifications.
While the exact biological role of YqhA remains uncharacterized, UPF0114 proteins are often implicated in bacterial stress responses or metabolic pathways . Limited studies suggest potential interactions with cellular proteins involved in:
Pathway Involvement: Hypothetical roles in bacterial survival or adaptation mechanisms .
Structural Insights: The His-tag facilitates X-ray crystallography or NMR studies to resolve its tertiary structure .
No direct functional assays (e.g., enzymatic activity) are reported in available literature.
Limited data on homologs in other E. coli strains or pathogens .
Structural Biology: Used in crystallization or cryo-EM studies to elucidate UPF0114 protein folds .
Protein-Protein Interactions: Co-IP or pull-down assays to identify binding partners .
Antibody Development: Serves as an antigen for generating polyclonal/monoclonal antibodies .
KEGG: ecq:ECED1_3653
The UPF0114 protein YqhA is a bacterial protein found in Escherichia coli that belongs to a family of proteins with currently unknown function (uncharacterized protein family 0114). The protein has been identified and characterized in various E. coli strains, including the O7:K1 strain (IAI39/ExPEC) . While the specific function remains under investigation, recombinant forms of this protein are utilized in research settings to explore its properties and potential roles in bacterial physiology.
The protein appears in various databases with specific identifiers, such as UniProt accession number B7NJ05 for the variant from E. coli O7:K1 strain . Current research suggests this protein may be involved in cellular processes that remain to be fully elucidated, making it a subject of ongoing investigation in the field of bacterial protein function and characterization.
Recombinant YqhA protein, as currently characterized, is typically produced as either a full-length or partial protein. Commercial preparations of the protein from E. coli O7:K1 strain have demonstrated purity levels of greater than 85% as determined by SDS-PAGE analysis . The protein can be produced with various tagging systems, though the specific tag type may vary depending on the manufacturing process or research methodology employed .
When working with recombinant YqhA, researchers should consider:
Expression source: Typically expressed in E. coli expression systems
Purity assessment: Generally evaluated using SDS-PAGE with expected purity >85%
Tag systems: May include various affinity tags determined during manufacturing or cloning process
Protein solubility: Like many recombinant proteins, may require optimization of expression conditions to maintain solubility
The stability and shelf life of recombinant YqhA protein depend on several factors including storage state, buffer components, storage temperature, and the inherent stability of the protein itself. For optimal results, the following handling protocols are recommended:
Storage conditions:
Liquid form: Typically stable for approximately 6 months when stored at -20°C/-80°C
Lyophilized form: Generally maintains stability for up to 12 months at -20°C/-80°C
Reconstitution protocol:
Briefly centrifuge vials prior to opening to ensure contents are at the bottom
Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL
For long-term storage, add glycerol to a final concentration of 5-50% (50% is often recommended as a standard practice)
Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles
Important handling notes:
Repeated freezing and thawing significantly reduces protein stability and functionality and should be avoided
Consider the buffer composition when designing experiments as it may affect protein behavior
Escherichia coli remains the predominant and most effective expression system for the production of recombinant YqhA protein. This preference is supported by several advantages of E. coli as an expression host:
Rapid growth kinetics: E. coli can achieve high cell densities in relatively short timeframes compared to other expression systems
Simplicity of genetic manipulation: Transformation with expression vectors can be performed in as little as 5 minutes, enabling rapid experimental iteration
Well-characterized physiology: The extensive knowledge base regarding E. coli physiology facilitates optimization of expression conditions
Economic feasibility: Rich complex media for E. coli cultivation can be made from readily available and inexpensive components
For recombinant YqhA specifically, E. coli-based expression has been successfully employed with yields sufficient for research applications . When selecting an E. coli strain for expression, researchers should consider:
BL21(DE3) and derivatives: Commonly used for T7 promoter-based expression systems
Strains with enhanced rare codon capacity: Important if the yqhA gene contains rare codons that might limit expression
Strains with reduced protease activity: To minimize degradation of the expressed protein
The selection of an appropriate expression vector is critical for successful recombinant YqhA protein production. Based on general recombinant protein expression principles, the following vector considerations are recommended:
Replicon and copy number:
Medium-copy vectors (15-60 copies per cell) such as those with the pMB1 origin (pET series) provide a good balance between expression level and metabolic burden
High-copy vectors like pUC series (500-700 copies per cell) may be considered if protein expression is challenging and higher gene dosage is required
For toxic proteins or those that affect cell viability, low-copy vectors may be preferable
Key vector series to consider:
pET series: Utilizes the T7 promoter system, can achieve expression levels where the target protein represents up to 50% of total cellular protein
pQE vectors: Features the ColE1 origin (15-20 copies per cell) and are compatible with various induction systems
pMAL series: Employs the tac promoter, which is approximately 10 times stronger than lacUV5
For dual expression experiments (such as co-expression of YqhA with potential interacting partners), vectors with the p15A origin (pACYC and pBAD series, 10-12 copies per cell) can be used in conjunction with pMB1/ColE1-based vectors .
The choice of promoter significantly impacts the expression levels and induction control of recombinant YqhA. Based on general principles of recombinant protein expression in E. coli, the following promoter systems warrant consideration:
T7 promoter system:
Found in pET vectors, this system can yield extraordinarily high expression levels, with target proteins potentially representing up to 50% of total cellular protein
Requires the presence of T7 RNA polymerase, typically provided by the λDE3 prophage integrated into the bacterial genome
Offers tight regulation through multiple control mechanisms: lacI repression, T7 lysozyme co-expression (via pLysS or pLysE plasmids), and hybrid T7/lac promoters
Strong hybrid promoters:
The tac promoter combines elements from the trp and lac promoters and is approximately 10 times stronger than lacUV5
Found in commercial vectors such as the pMAL series, providing robust expression with IPTG induction
Lambda pL promoter:
Offers tight regulation and strong expression upon induction
Controlled by the λcI repressor protein, which can be inactivated by triggering the SOS response (using nalidixic acid) or by temperature shifting in temperature-sensitive variants
Cold-shock promoter system:
The cspA promoter remains active at low temperatures (15-23°C), enabling expression at conditions that may improve protein solubility
Particularly valuable for proteins prone to inclusion body formation, potentially including YqhA if solubility issues are encountered
Comparative expression levels of different promoter systems:
| Promoter System | Relative Strength | Induction Method | Leaky Expression | Best Application for YqhA |
|---|---|---|---|---|
| T7 | Very High | IPTG | Low with pLysS | Maximum yield |
| tac | High | IPTG | Moderate | Balanced expression |
| Lambda pL | High | Temperature/Nalidixic acid | Very low | Tight control needed |
| cspA | Moderate | Temperature shift | Low | Enhanced solubility |
| lacUV5 | Low | IPTG | Moderate | Mild expression |
The selection of an appropriate affinity tag is crucial for efficient purification of recombinant YqhA protein. While the specific tag for commercial YqhA preparations is determined during the manufacturing process , researchers developing their own expression systems should consider these options:
Common affinity tags for protein purification:
Polyhistidine tag (His-tag):
Most widely used due to its small size (6-10 histidine residues)
Compatible with immobilized metal affinity chromatography (IMAC)
Minimal interference with protein structure and function
Can be placed at either N- or C-terminus
Glutathione S-transferase (GST) tag:
Enhances solubility of fusion proteins
Enables single-step purification using glutathione agarose
Larger size (26 kDa) may affect structural studies
Maltose-binding protein (MBP) tag:
Significantly enhances solubility, particularly valuable if YqhA shows insolubility issues
High-affinity binding to amylose resin
Large size (43 kDa) requires removal for certain applications
Small ubiquitin-like modifier (SUMO) tag:
Enhances expression and solubility
Precise removal via SUMO protease leaves no additional residues
Growing popularity for structural biology applications
For YqhA specifically, the selection of an affinity tag should consider:
The intended experimental applications (structural studies vs. functional assays)
Whether the tag will be removed after purification
Potential impact on protein solubility and activity
A comprehensive purification strategy for recombinant YqhA protein typically involves multiple chromatographic steps. Based on general protein purification principles, the following protocol is recommended:
Affinity chromatography based on the selected tag (e.g., IMAC for His-tagged YqhA)
Equilibrate column with appropriate buffer (typically phosphate or Tris-based)
Load clarified cell lysate
Wash extensively to remove non-specifically bound proteins
Elute with competitive agent (e.g., imidazole for His-tagged proteins)
Ion exchange chromatography based on YqhA's theoretical isoelectric point
Size exclusion chromatography to separate monomeric protein from aggregates
Consider hydroxyapatite chromatography as an orthogonal purification method
Final size exclusion chromatography in the buffer required for downstream applications
Concentrate purified protein using appropriate molecular weight cutoff filters
Western blotting to confirm identity
Mass spectrometry for precise molecular weight determination
Dynamic light scattering to assess homogeneity
For tag removal, if required:
Select appropriate protease based on the cleavage site engineered between the tag and YqhA
Optimize cleavage conditions (time, temperature, enzyme:substrate ratio)
Perform reverse affinity chromatography to separate cleaved tag from the protein
Comprehensive characterization of purified recombinant YqhA protein is essential to ensure its suitability for downstream applications. The following analytical methods are recommended:
Purity assessment:
SDS-PAGE analysis with Coomassie or silver staining - target >85% purity
Capillary electrophoresis for higher resolution analysis
High-performance liquid chromatography (HPLC) with appropriate columns
Western blotting with specific antibodies against YqhA or the affinity tag
Structural integrity:
Circular dichroism (CD) spectroscopy to assess secondary structure content
Fluorescence spectroscopy to examine tertiary structure
Mass spectrometry to confirm molecular mass and identify potential post-translational modifications
Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine oligomeric state
Functional characterization:
Since the specific function of YqhA remains uncharacterized, functional assays may need to be developed based on:
Protein-protein interaction studies (pull-down assays, surface plasmon resonance)
Enzymatic activity screens based on predicted functional domains
Phenotypic rescue experiments in yqhA-knockout strains
Structural studies to identify potential active sites or binding pockets
Stability assessment:
Differential scanning fluorimetry (DSF) to determine thermal stability
Time-course studies at different temperatures to assess long-term stability
Aggregation analysis by dynamic light scattering
Storage stability at different conditions (temperature, buffer composition, etc.)
While the specific function of YqhA remains under investigation, advanced research approaches can help elucidate its role in bacterial physiology:
Genetic approaches:
Creation of yqhA knockout strains to observe phenotypic effects
Complementation studies with wild-type and mutant alleles
Transcriptomic analysis to identify conditions that alter yqhA expression
Genetic interaction mapping through synthetic lethality screens
Biochemical approaches:
Identification of interaction partners through co-immunoprecipitation coupled with mass spectrometry
Metabolomic profiling of wild-type versus yqhA mutant strains
In vitro reconstitution of potential biochemical activities
Structural studies to identify potential functional domains
Potential roles in pathogenicity:
Given that YqhA has been identified in pathogenic strains like E. coli O7:K1 (IAI39/ExPEC) , investigating its potential contribution to virulence is warranted through:
Virulence assays comparing wild-type and yqhA mutant strains
Host-pathogen interaction studies
Expression analysis during infection models
Comparative genomics across pathogenic and non-pathogenic strains
Understanding the structural features of YqhA provides insights into its potential function and evolutionary relationships:
Structural prediction and analysis:
Secondary structure prediction algorithms suggest specific patterns of α-helices and β-sheets
Tertiary structure modeling using homology-based approaches or ab initio methods
Identification of conserved domains and potential active sites
Analysis of surface electrostatic properties to predict interaction interfaces
Comparative structural analysis:
Sequence alignment with other UPF0114 family members to identify conserved residues
Structural superposition with related proteins of known function
Evolutionary analysis to identify co-evolved residues
Experimental structure determination approaches:
X-ray crystallography of purified recombinant YqhA
Nuclear magnetic resonance (NMR) spectroscopy for solution structure
Cryo-electron microscopy if YqhA forms larger complexes
To comprehensively characterize YqhA's interactome and functional relationships, several methodological approaches can be employed:
In vitro interaction studies:
Pull-down assays using tagged recombinant YqhA as bait
Surface plasmon resonance (SPR) to determine binding kinetics
Isothermal titration calorimetry (ITC) for thermodynamic parameters of interactions
Microscale thermophoresis for detecting weak interactions
In vivo interaction mapping:
Bacterial two-hybrid screening to identify potential interaction partners
Proximity-dependent biotin identification (BioID) to capture transient interactions
Co-immunoprecipitation followed by mass spectrometry
Fluorescence resonance energy transfer (FRET) imaging with fluorescently tagged proteins
Functional interaction networks:
Genetic interaction mapping through synthetic genetic array analysis
Phenotypic profiling of double mutants
Proteomic changes in response to YqhA depletion or overexpression
Metabolic flux analysis to identify pathways affected by YqhA manipulation
Low expression yields of recombinant YqhA can be addressed through systematic optimization of expression conditions:
Genetic optimization:
Codon optimization for E. coli expression, particularly if rare codons are present in the yqhA sequence
Testing different promoter systems (T7, tac, λpL) to identify optimal expression control
Evaluating different fusion partners known to enhance expression (MBP, SUMO, Thioredoxin)
Engineering mRNA stability elements in the expression construct
Host strain selection:
Testing multiple E. coli strains optimized for protein expression (BL21, BL21(DE3), Rosetta, etc.)
Using strains with enhanced rare codon capability if needed
Considering strains with reduced protease activity to minimize degradation
Cultivation conditions:
Optimizing induction parameters:
IPTG concentration (typically 0.1-1.0 mM)
Cell density at induction (mid-log phase often optimal)
Post-induction temperature (lower temperatures of 16-25°C may improve folding)
Duration of expression (4 hours to overnight)
Media optimization:
Rich media vs. defined media
Addition of supplements that may enhance expression or folding
Consideration of auto-induction media for controlled induction
Experimental decision matrix for optimizing YqhA expression:
| Parameter | Variables to Test | Expected Impact | Analysis Method |
|---|---|---|---|
| Promoter | T7, tac, λpL, cspA | Expression level and timing | SDS-PAGE, Western blot |
| E. coli strain | BL21(DE3), Rosetta, C41/C43 | Expression yield, solubility | SDS-PAGE, solubility analysis |
| Induction temperature | 37°C, 30°C, 25°C, 16°C | Folding efficiency, solubility | Solubility analysis, activity assays |
| Induction OD600 | 0.4, 0.6, 0.8, 1.0 | Biomass vs. expression balance | Normalized yield calculation |
| IPTG concentration | 0.1 mM, 0.5 mM, 1.0 mM | Expression level, toxicity | Growth curves, expression analysis |
Protein insolubility is a common challenge in recombinant protein expression that can be addressed through multiple approaches:
Expression condition modifications:
Lowering the expression temperature (16-25°C) to slow protein synthesis and facilitate proper folding
Reducing inducer concentration to decrease expression rate
Using the cold-shock promoter system (cspA) which remains active at lower temperatures (15-23°C)
Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE, trigger factor)
Fusion protein strategies:
SUMO tag - promotes correct folding
Thioredoxin (Trx) - creates an oxidizing environment that can facilitate proper disulfide bond formation
NusA - highly soluble protein that can enhance fusion partner solubility
Buffer optimization:
Screening different pH conditions (typically pH 6.0-8.0)
Testing various salt concentrations (100-500 mM)
Addition of solubility enhancers:
Non-detergent sulfobetaines (NDSB)
Low concentrations of non-ionic detergents (0.05-0.1% Triton X-100)
Glycerol (5-10%)
Arginine (50-100 mM)
Inclusion body processing:
If YqhA persistently forms inclusion bodies despite optimization attempts:
Isolation and purification of inclusion bodies
Solubilization using strong denaturants (8M urea or 6M guanidine hydrochloride)
Refolding through dialysis, dilution, or on-column refolding methods
Addition of redox pairs (GSH/GSSG) if disulfide bonds are present
Developing conditions that maintain YqhA in its native functional state is critical for meaningful biochemical and biophysical studies:
Buffer optimization for stability:
Systematic screening of buffer conditions:
Buffer type (phosphate, Tris, HEPES, MES at 20-100 mM)
pH range (typically 6.0-8.0 in 0.5 pH unit increments)
Ionic strength (NaCl at 50-500 mM)
Additives (glycerol, reducing agents, divalent cations)
Thermal shift assays to identify stabilizing conditions:
Differential scanning fluorimetry with SYPRO Orange
Monitoring protein unfolding as a function of temperature
Identifying buffer components that increase melting temperature
Activity assay development:
Since YqhA's function is not fully characterized, developing potential activity assays requires:
Bioinformatic analysis to predict potential biochemical activities
Designing assays based on predicted function (enzymatic, binding, etc.)
Screening for activity under diverse conditions
Validation of activity through mutagenesis of predicted key residues
Interaction studies optimization:
Surface plasmon resonance (SPR) buffer optimization:
Minimizing non-specific binding
Reducing surface regeneration requirements
Ensuring signal stability
Pull-down assay conditions:
Determining optimal binding and washing stringency
Identifying blocking agents to reduce background
Optimizing elution conditions
Co-immunoprecipitation from cellular extracts:
Lysis buffer optimization to maintain interactions
Cross-linking parameters if interactions are transient
Antibody selection and validation