Recombinant Escherichia coli O81 UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Escherichia coli O81 UPF0114 protein YqhA (yqhA) is a full-length recombinant protein derived from the yqhA gene (UniProt ID: B7MZZ0) in E. coli strain O81. It is expressed in E. coli with an N-terminal His tag for purification and structural studies. The protein spans 164 amino acids (MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH) .

AttributeDetails
Gene NameyqhA
SynonymsUPF0114 protein YqhA; ECED1_3653
Molecular Weight~18,641 Da
Purity>90% (SDS-PAGE)
TagN-terminal His tag
Expression HostE. coli
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0 (with 50% glycerol for lyophilized forms)

Production and Purification

The protein is produced via recombinant DNA technology using E. coli as the expression system. Key steps include:

  • Cloning: The yqhA gene is inserted into a plasmid vector under a T7 or lac promoter for inducible expression .

  • Expression: Induced with IPTG (isopropyl β-D-1-thiogalactopyranoside) or temperature shifts to optimize yield .

  • Purification: Affinity chromatography (via the His tag) followed by dialysis and lyophilization .

Critical Handling Notes:

  • Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

  • Reconstitute in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

Supplier Comparison

Multiple vendors provide this protein with slight variations in specifications.

SupplierProduct CodePurityMolecular WeightFormKey Features
Creative BioMartRFL6401EF>90%~18.6 kDaLyophilized powderHis-tagged, Tris/PBS buffer
MyBioSourceMBS1092380≥85%~18.6 kDaLyophilized/liquidOptimized for research-grade purity
GeneBioSystemsN/AN/A~18.6 kDaLyophilizedIncludes glycerol for stability

Functional and Research Context

While the exact biological role of YqhA remains uncharacterized, UPF0114 proteins are often implicated in bacterial stress responses or metabolic pathways . Limited studies suggest potential interactions with cellular proteins involved in:

  • Pathway Involvement: Hypothetical roles in bacterial survival or adaptation mechanisms .

  • Structural Insights: The His-tag facilitates X-ray crystallography or NMR studies to resolve its tertiary structure .

Research Gaps:

  • No direct functional assays (e.g., enzymatic activity) are reported in available literature.

  • Limited data on homologs in other E. coli strains or pathogens .

Applications in Research

  1. Structural Biology: Used in crystallization or cryo-EM studies to elucidate UPF0114 protein folds .

  2. Protein-Protein Interactions: Co-IP or pull-down assays to identify binding partners .

  3. Antibody Development: Serves as an antigen for generating polyclonal/monoclonal antibodies .

Challenges and Considerations

  • Solubility: Aggregation may occur under non-optimal conditions; low-temperature induction (e.g., 15–25°C) is recommended .

  • Contamination Risk: E. coli host proteins or His-tagged contaminants may require additional purification steps .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqhA; ECED1_3653; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
yqhA
Target Protein Sequence
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the UPF0114 protein YqhA and what is known about its function?

The UPF0114 protein YqhA is a bacterial protein found in Escherichia coli that belongs to a family of proteins with currently unknown function (uncharacterized protein family 0114). The protein has been identified and characterized in various E. coli strains, including the O7:K1 strain (IAI39/ExPEC) . While the specific function remains under investigation, recombinant forms of this protein are utilized in research settings to explore its properties and potential roles in bacterial physiology.

The protein appears in various databases with specific identifiers, such as UniProt accession number B7NJ05 for the variant from E. coli O7:K1 strain . Current research suggests this protein may be involved in cellular processes that remain to be fully elucidated, making it a subject of ongoing investigation in the field of bacterial protein function and characterization.

What are the basic characteristics of recombinant YqhA protein?

Recombinant YqhA protein, as currently characterized, is typically produced as either a full-length or partial protein. Commercial preparations of the protein from E. coli O7:K1 strain have demonstrated purity levels of greater than 85% as determined by SDS-PAGE analysis . The protein can be produced with various tagging systems, though the specific tag type may vary depending on the manufacturing process or research methodology employed .

When working with recombinant YqhA, researchers should consider:

  • Expression source: Typically expressed in E. coli expression systems

  • Purity assessment: Generally evaluated using SDS-PAGE with expected purity >85%

  • Tag systems: May include various affinity tags determined during manufacturing or cloning process

  • Protein solubility: Like many recombinant proteins, may require optimization of expression conditions to maintain solubility

How is recombinant YqhA protein typically stored and handled?

The stability and shelf life of recombinant YqhA protein depend on several factors including storage state, buffer components, storage temperature, and the inherent stability of the protein itself. For optimal results, the following handling protocols are recommended:

Storage conditions:

  • Liquid form: Typically stable for approximately 6 months when stored at -20°C/-80°C

  • Lyophilized form: Generally maintains stability for up to 12 months at -20°C/-80°C

  • Working aliquots: Can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge vials prior to opening to ensure contents are at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is often recommended as a standard practice)

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

Important handling notes:

  • Repeated freezing and thawing significantly reduces protein stability and functionality and should be avoided

  • Consider the buffer composition when designing experiments as it may affect protein behavior

What expression systems are most effective for recombinant YqhA protein production?

Escherichia coli remains the predominant and most effective expression system for the production of recombinant YqhA protein. This preference is supported by several advantages of E. coli as an expression host:

  • Rapid growth kinetics: E. coli can achieve high cell densities in relatively short timeframes compared to other expression systems

  • Simplicity of genetic manipulation: Transformation with expression vectors can be performed in as little as 5 minutes, enabling rapid experimental iteration

  • Well-characterized physiology: The extensive knowledge base regarding E. coli physiology facilitates optimization of expression conditions

  • Economic feasibility: Rich complex media for E. coli cultivation can be made from readily available and inexpensive components

For recombinant YqhA specifically, E. coli-based expression has been successfully employed with yields sufficient for research applications . When selecting an E. coli strain for expression, researchers should consider:

  • BL21(DE3) and derivatives: Commonly used for T7 promoter-based expression systems

  • Strains with enhanced rare codon capacity: Important if the yqhA gene contains rare codons that might limit expression

  • Strains with reduced protease activity: To minimize degradation of the expressed protein

What plasmid vectors are recommended for optimal YqhA expression?

The selection of an appropriate expression vector is critical for successful recombinant YqhA protein production. Based on general recombinant protein expression principles, the following vector considerations are recommended:

Replicon and copy number:

  • Medium-copy vectors (15-60 copies per cell) such as those with the pMB1 origin (pET series) provide a good balance between expression level and metabolic burden

  • High-copy vectors like pUC series (500-700 copies per cell) may be considered if protein expression is challenging and higher gene dosage is required

  • For toxic proteins or those that affect cell viability, low-copy vectors may be preferable

Key vector series to consider:

  • pET series: Utilizes the T7 promoter system, can achieve expression levels where the target protein represents up to 50% of total cellular protein

  • pQE vectors: Features the ColE1 origin (15-20 copies per cell) and are compatible with various induction systems

  • pMAL series: Employs the tac promoter, which is approximately 10 times stronger than lacUV5

For dual expression experiments (such as co-expression of YqhA with potential interacting partners), vectors with the p15A origin (pACYC and pBAD series, 10-12 copies per cell) can be used in conjunction with pMB1/ColE1-based vectors .

What promoter systems yield the highest expression of YqhA protein?

The choice of promoter significantly impacts the expression levels and induction control of recombinant YqhA. Based on general principles of recombinant protein expression in E. coli, the following promoter systems warrant consideration:

T7 promoter system:

  • Found in pET vectors, this system can yield extraordinarily high expression levels, with target proteins potentially representing up to 50% of total cellular protein

  • Requires the presence of T7 RNA polymerase, typically provided by the λDE3 prophage integrated into the bacterial genome

  • Offers tight regulation through multiple control mechanisms: lacI repression, T7 lysozyme co-expression (via pLysS or pLysE plasmids), and hybrid T7/lac promoters

Strong hybrid promoters:

  • The tac promoter combines elements from the trp and lac promoters and is approximately 10 times stronger than lacUV5

  • Found in commercial vectors such as the pMAL series, providing robust expression with IPTG induction

Lambda pL promoter:

  • Offers tight regulation and strong expression upon induction

  • Controlled by the λcI repressor protein, which can be inactivated by triggering the SOS response (using nalidixic acid) or by temperature shifting in temperature-sensitive variants

Cold-shock promoter system:

  • The cspA promoter remains active at low temperatures (15-23°C), enabling expression at conditions that may improve protein solubility

  • Particularly valuable for proteins prone to inclusion body formation, potentially including YqhA if solubility issues are encountered

Comparative expression levels of different promoter systems:

Promoter SystemRelative StrengthInduction MethodLeaky ExpressionBest Application for YqhA
T7Very HighIPTGLow with pLysSMaximum yield
tacHighIPTGModerateBalanced expression
Lambda pLHighTemperature/Nalidixic acidVery lowTight control needed
cspAModerateTemperature shiftLowEnhanced solubility
lacUV5LowIPTGModerateMild expression

What affinity tags are recommended for YqhA purification?

The selection of an appropriate affinity tag is crucial for efficient purification of recombinant YqhA protein. While the specific tag for commercial YqhA preparations is determined during the manufacturing process , researchers developing their own expression systems should consider these options:

Common affinity tags for protein purification:

  • Polyhistidine tag (His-tag):

    • Most widely used due to its small size (6-10 histidine residues)

    • Compatible with immobilized metal affinity chromatography (IMAC)

    • Minimal interference with protein structure and function

    • Can be placed at either N- or C-terminus

  • Glutathione S-transferase (GST) tag:

    • Enhances solubility of fusion proteins

    • Enables single-step purification using glutathione agarose

    • Larger size (26 kDa) may affect structural studies

  • Maltose-binding protein (MBP) tag:

    • Significantly enhances solubility, particularly valuable if YqhA shows insolubility issues

    • High-affinity binding to amylose resin

    • Large size (43 kDa) requires removal for certain applications

  • Small ubiquitin-like modifier (SUMO) tag:

    • Enhances expression and solubility

    • Precise removal via SUMO protease leaves no additional residues

    • Growing popularity for structural biology applications

For YqhA specifically, the selection of an affinity tag should consider:

  • The intended experimental applications (structural studies vs. functional assays)

  • Whether the tag will be removed after purification

  • Potential impact on protein solubility and activity

What are the optimal purification protocols for YqhA protein?

A comprehensive purification strategy for recombinant YqhA protein typically involves multiple chromatographic steps. Based on general protein purification principles, the following protocol is recommended:

Step 1: Initial capture

  • Affinity chromatography based on the selected tag (e.g., IMAC for His-tagged YqhA)

  • Equilibrate column with appropriate buffer (typically phosphate or Tris-based)

  • Load clarified cell lysate

  • Wash extensively to remove non-specifically bound proteins

  • Elute with competitive agent (e.g., imidazole for His-tagged proteins)

Step 2: Intermediate purification

  • Ion exchange chromatography based on YqhA's theoretical isoelectric point

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Consider hydroxyapatite chromatography as an orthogonal purification method

Step 3: Polishing

  • Final size exclusion chromatography in the buffer required for downstream applications

  • Concentrate purified protein using appropriate molecular weight cutoff filters

Step 4: Quality assessment

  • SDS-PAGE analysis to confirm purity (target >85% purity)

  • Western blotting to confirm identity

  • Mass spectrometry for precise molecular weight determination

  • Dynamic light scattering to assess homogeneity

For tag removal, if required:

  • Select appropriate protease based on the cleavage site engineered between the tag and YqhA

  • Optimize cleavage conditions (time, temperature, enzyme:substrate ratio)

  • Perform reverse affinity chromatography to separate cleaved tag from the protein

How can researchers assess the purity and activity of recombinant YqhA?

Comprehensive characterization of purified recombinant YqhA protein is essential to ensure its suitability for downstream applications. The following analytical methods are recommended:

Purity assessment:

  • SDS-PAGE analysis with Coomassie or silver staining - target >85% purity

  • Capillary electrophoresis for higher resolution analysis

  • High-performance liquid chromatography (HPLC) with appropriate columns

  • Western blotting with specific antibodies against YqhA or the affinity tag

Structural integrity:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Fluorescence spectroscopy to examine tertiary structure

  • Mass spectrometry to confirm molecular mass and identify potential post-translational modifications

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine oligomeric state

Functional characterization:
Since the specific function of YqhA remains uncharacterized, functional assays may need to be developed based on:

  • Protein-protein interaction studies (pull-down assays, surface plasmon resonance)

  • Enzymatic activity screens based on predicted functional domains

  • Phenotypic rescue experiments in yqhA-knockout strains

  • Structural studies to identify potential active sites or binding pockets

Stability assessment:

  • Differential scanning fluorimetry (DSF) to determine thermal stability

  • Time-course studies at different temperatures to assess long-term stability

  • Aggregation analysis by dynamic light scattering

  • Storage stability at different conditions (temperature, buffer composition, etc.)

How does YqhA contribute to bacterial physiology and potential pathogenicity?

While the specific function of YqhA remains under investigation, advanced research approaches can help elucidate its role in bacterial physiology:

Genetic approaches:

  • Creation of yqhA knockout strains to observe phenotypic effects

  • Complementation studies with wild-type and mutant alleles

  • Transcriptomic analysis to identify conditions that alter yqhA expression

  • Genetic interaction mapping through synthetic lethality screens

Biochemical approaches:

  • Identification of interaction partners through co-immunoprecipitation coupled with mass spectrometry

  • Metabolomic profiling of wild-type versus yqhA mutant strains

  • In vitro reconstitution of potential biochemical activities

  • Structural studies to identify potential functional domains

Potential roles in pathogenicity:
Given that YqhA has been identified in pathogenic strains like E. coli O7:K1 (IAI39/ExPEC) , investigating its potential contribution to virulence is warranted through:

  • Virulence assays comparing wild-type and yqhA mutant strains

  • Host-pathogen interaction studies

  • Expression analysis during infection models

  • Comparative genomics across pathogenic and non-pathogenic strains

What structural characteristics define YqhA and how does it compare to other UPF0114 family members?

Understanding the structural features of YqhA provides insights into its potential function and evolutionary relationships:

Structural prediction and analysis:

  • Secondary structure prediction algorithms suggest specific patterns of α-helices and β-sheets

  • Tertiary structure modeling using homology-based approaches or ab initio methods

  • Identification of conserved domains and potential active sites

  • Analysis of surface electrostatic properties to predict interaction interfaces

Comparative structural analysis:

  • Sequence alignment with other UPF0114 family members to identify conserved residues

  • Structural superposition with related proteins of known function

  • Evolutionary analysis to identify co-evolved residues

Experimental structure determination approaches:

  • X-ray crystallography of purified recombinant YqhA

  • Nuclear magnetic resonance (NMR) spectroscopy for solution structure

  • Cryo-electron microscopy if YqhA forms larger complexes

What experimental designs best investigate YqhA protein interactions with other cellular components?

To comprehensively characterize YqhA's interactome and functional relationships, several methodological approaches can be employed:

In vitro interaction studies:

  • Pull-down assays using tagged recombinant YqhA as bait

  • Surface plasmon resonance (SPR) to determine binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters of interactions

  • Microscale thermophoresis for detecting weak interactions

In vivo interaction mapping:

  • Bacterial two-hybrid screening to identify potential interaction partners

  • Proximity-dependent biotin identification (BioID) to capture transient interactions

  • Co-immunoprecipitation followed by mass spectrometry

  • Fluorescence resonance energy transfer (FRET) imaging with fluorescently tagged proteins

Functional interaction networks:

  • Genetic interaction mapping through synthetic genetic array analysis

  • Phenotypic profiling of double mutants

  • Proteomic changes in response to YqhA depletion or overexpression

  • Metabolic flux analysis to identify pathways affected by YqhA manipulation

How can researchers address low expression yields of YqhA protein?

Low expression yields of recombinant YqhA can be addressed through systematic optimization of expression conditions:

Genetic optimization:

  • Codon optimization for E. coli expression, particularly if rare codons are present in the yqhA sequence

  • Testing different promoter systems (T7, tac, λpL) to identify optimal expression control

  • Evaluating different fusion partners known to enhance expression (MBP, SUMO, Thioredoxin)

  • Engineering mRNA stability elements in the expression construct

Host strain selection:

  • Testing multiple E. coli strains optimized for protein expression (BL21, BL21(DE3), Rosetta, etc.)

  • Using strains with enhanced rare codon capability if needed

  • Considering strains with reduced protease activity to minimize degradation

Cultivation conditions:

  • Optimizing induction parameters:

    • IPTG concentration (typically 0.1-1.0 mM)

    • Cell density at induction (mid-log phase often optimal)

    • Post-induction temperature (lower temperatures of 16-25°C may improve folding)

    • Duration of expression (4 hours to overnight)

  • Media optimization:

    • Rich media vs. defined media

    • Addition of supplements that may enhance expression or folding

    • Consideration of auto-induction media for controlled induction

Experimental decision matrix for optimizing YqhA expression:

ParameterVariables to TestExpected ImpactAnalysis Method
PromoterT7, tac, λpL, cspAExpression level and timingSDS-PAGE, Western blot
E. coli strainBL21(DE3), Rosetta, C41/C43Expression yield, solubilitySDS-PAGE, solubility analysis
Induction temperature37°C, 30°C, 25°C, 16°CFolding efficiency, solubilitySolubility analysis, activity assays
Induction OD6000.4, 0.6, 0.8, 1.0Biomass vs. expression balanceNormalized yield calculation
IPTG concentration0.1 mM, 0.5 mM, 1.0 mMExpression level, toxicityGrowth curves, expression analysis

What strategies can resolve insolubility issues with recombinant YqhA?

Protein insolubility is a common challenge in recombinant protein expression that can be addressed through multiple approaches:

Expression condition modifications:

  • Lowering the expression temperature (16-25°C) to slow protein synthesis and facilitate proper folding

  • Reducing inducer concentration to decrease expression rate

  • Using the cold-shock promoter system (cspA) which remains active at lower temperatures (15-23°C)

  • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE, trigger factor)

Fusion protein strategies:

  • MBP tag - particularly effective for enhancing solubility

  • SUMO tag - promotes correct folding

  • Thioredoxin (Trx) - creates an oxidizing environment that can facilitate proper disulfide bond formation

  • NusA - highly soluble protein that can enhance fusion partner solubility

Buffer optimization:

  • Screening different pH conditions (typically pH 6.0-8.0)

  • Testing various salt concentrations (100-500 mM)

  • Addition of solubility enhancers:

    • Non-detergent sulfobetaines (NDSB)

    • Low concentrations of non-ionic detergents (0.05-0.1% Triton X-100)

    • Glycerol (5-10%)

    • Arginine (50-100 mM)

Inclusion body processing:
If YqhA persistently forms inclusion bodies despite optimization attempts:

  • Isolation and purification of inclusion bodies

  • Solubilization using strong denaturants (8M urea or 6M guanidine hydrochloride)

  • Refolding through dialysis, dilution, or on-column refolding methods

  • Addition of redox pairs (GSH/GSSG) if disulfide bonds are present

How can researchers optimize conditions for functional studies of YqhA?

Developing conditions that maintain YqhA in its native functional state is critical for meaningful biochemical and biophysical studies:

Buffer optimization for stability:

  • Systematic screening of buffer conditions:

    • Buffer type (phosphate, Tris, HEPES, MES at 20-100 mM)

    • pH range (typically 6.0-8.0 in 0.5 pH unit increments)

    • Ionic strength (NaCl at 50-500 mM)

    • Additives (glycerol, reducing agents, divalent cations)

  • Thermal shift assays to identify stabilizing conditions:

    • Differential scanning fluorimetry with SYPRO Orange

    • Monitoring protein unfolding as a function of temperature

    • Identifying buffer components that increase melting temperature

Activity assay development:
Since YqhA's function is not fully characterized, developing potential activity assays requires:

  • Bioinformatic analysis to predict potential biochemical activities

  • Designing assays based on predicted function (enzymatic, binding, etc.)

  • Screening for activity under diverse conditions

  • Validation of activity through mutagenesis of predicted key residues

Interaction studies optimization:

  • Surface plasmon resonance (SPR) buffer optimization:

    • Minimizing non-specific binding

    • Reducing surface regeneration requirements

    • Ensuring signal stability

  • Pull-down assay conditions:

    • Determining optimal binding and washing stringency

    • Identifying blocking agents to reduce background

    • Optimizing elution conditions

  • Co-immunoprecipitation from cellular extracts:

    • Lysis buffer optimization to maintain interactions

    • Cross-linking parameters if interactions are transient

    • Antibody selection and validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.