Recombinant Escherichia coli O81 UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Escherichia coli O81 UPF0208 membrane protein YfbV (yfbV) is a protein expressed in an in vitro E. coli expression system . It is a membrane protein derived from Escherichia coli O81, strain ED1a . YfbV is also known under the synonyms yfbV, ECED1_2759, and UPF0208 membrane protein YfbV. The protein belongs to the UPF0208 family.

Properties

YfbV has a molecular weight of approximately 17 kDa . The full-length protein consists of 151 amino acids . The target protein sequence is: MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQLDKTFLDDL . The isoelectric point is 5.28 .

Function and Localization

YfbV is annotated as a UPF0208 family protein, but its precise function remains largely unknown. As a membrane protein, it is likely located in the cell membrane.

Expression and Purification

Escherichia coli is a common host for recombinant membrane protein production, but it can be hampered by poor cellular accumulation and toxicity for the host . Optimization of gene overexpression and culturing conditions can maximize the accumulation of membrane-integrated and well-folded recombinant membrane proteins in E. coli strains .

Immunogenicity

Recombinant outer membrane proteins in E. coli can trigger considerable immune responses, making them potential candidates for vaccine development .

Applications

Recombinant YfbV may be used in various research applications, including:

  • ELISA assays

  • Structural studies

  • Functional studies

  • Antibody production

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request if possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
yfbV; ECED1_2759; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is known about the function of YfbV membrane protein?

The function of YfbV remains largely uncharacterized, which is reflected in its UPF (Uncharacterized Protein Family) designation. The UPF0208 family comprises membrane proteins with unknown function. Based on its membrane localization and structural features, it may play roles in:

  • Membrane integrity or stability

  • Transport of small molecules

  • Signal transduction

  • Protein-protein interactions at the membrane interface

Researchers investigating this protein typically approach functional characterization through:

  • Comparative genomics with known membrane proteins

  • Gene knockout/complementation studies

  • Protein-protein interaction analyses

  • Transport assays if a transport function is suspected

What expression systems are optimal for recombinant YfbV production?

E. coli remains the preferred expression system for YfbV, as demonstrated in multiple commercial and research preparations . The advantages of E. coli for YfbV expression include:

For YfbV specifically, E. coli has successfully been used with N-terminal His-tagging for purification purposes . The protein has been expressed in its full-length form (1-151 amino acids) with functional integrity.

What are the optimal conditions for soluble expression of YfbV?

Achieving high yields of soluble YfbV requires careful optimization of expression conditions. Based on general principles for membrane protein expression in E. coli and available data on YfbV:

ParameterOptimal RangeEffect on YfbV Expression
Temperature18-25°CLower temperatures reduce aggregation and increase proper folding
Inducer concentration0.1-0.5 mM IPTGLower concentrations prevent overwhelming the membrane insertion machinery
Induction time4-6 hoursLonger times may lead to degradation or reduced productivity
Media compositionLB with glycerol (0.5-2%)Glycerol stabilizes membranes
Growth phase at inductionMid-log phase (OD600 0.6-0.8)Balances cell density and metabolic capacity

Experimental design approaches using fractional factorial screening have proven effective for optimizing membrane protein expression parameters . Such approaches allow researchers to systematically evaluate multiple variables simultaneously, including media composition and induction conditions, to identify optimal expression parameters for YfbV.

What purification strategies are most effective for His-tagged YfbV?

Purification of His-tagged YfbV typically follows this protocol:

  • Membrane extraction: Cells are lysed and membranes isolated by ultracentrifugation

  • Solubilization: Membranes are treated with detergents (common choices include DDM, LDAO, or C12E8)

  • IMAC purification: The solubilized protein is purified using Ni-NTA or similar metal affinity resin

  • Size exclusion chromatography: Further purification to remove aggregates and contaminants

A typical purification workflow yields approximately 75-90% homogeneity, with yields of 5-10 mg/L culture for membrane proteins like YfbV . Storage in Tris/PBS-based buffer containing trehalose (6%) at pH 8.0 maintains stability, with recommended storage at -20°C/-80°C with 50% glycerol for long-term stability .

How can cellular stress responses during YfbV expression be minimized?

Membrane protein overexpression often triggers stress responses in E. coli, reducing yields and protein quality. Specific strategies to minimize stress during YfbV expression include:

Stress ResponseMitigation StrategyMolecular Mechanism
Membrane protein insertion stressLower induction temperature (18-22°C)Reduces expression rate to match membrane insertion capacity
Reduced inducer concentrationPrevents overwhelming the translocon machinery
Misfolded protein responseCo-expression of chaperones (DnaK/J, GroEL/ES)Assists in proper folding
Addition of chemical chaperones (glycerol, sorbitol)Stabilizes protein conformations
Metabolic burdenRich media with balanced carbon sourcesProvides resources for both growth and protein production
Controlled feeding in fermentationMaintains optimal nutrient levels

Recent research has identified genes upregulated or downregulated during poor membrane protein insertion, providing potential targets for strain engineering . Successful overproduction of membrane proteins is directly linked to avoiding these stress responses in the host cell .

What analytical methods are most suitable for characterizing YfbV membrane integration?

Characterizing the membrane integration of YfbV requires specialized analytical approaches:

  • Membrane fractionation: Separation of inner and outer membranes followed by western blotting to determine localization

  • Protease accessibility assays: Limited proteolysis of membrane vesicles to determine topology

  • Fluorescence-based approaches:

    • GFP fusion analysis to assess folding and membrane insertion

    • Site-specific fluorescent labeling to probe accessibility

  • Structural analysis:

    • Circular dichroism (CD) to assess secondary structure content

    • Limited proteolysis coupled with mass spectrometry to identify stable domains

  • Functional reconstitution: Incorporation into liposomes to assess functional activity if transport activity is suspected

The translocon machinery (SecYEG complex in E. coli) decides whether protein segments integrate into the membrane based on the hydrophobicity and charge distribution of the polypeptide . Understanding this process for YfbV specifically requires experimental validation using the methods above.

Why might YfbV express poorly despite using optimized conditions?

Several factors may contribute to poor YfbV expression even under seemingly optimized conditions:

  • Codon usage discrepancies: E. coli O81 may have different codon preferences than the expression host strain. Codon optimization or co-expression of rare tRNAs may help.

  • Toxicity: Overexpression may cause membrane stress or disrupt essential cellular processes. Strategies include:

    • Using tightly controlled inducible promoters

    • Expressing in C41/C43 strains specifically developed for toxic membrane proteins

    • Using Lemo21(DE3) strain with tunable expression level

  • mRNA secondary structure: Strong secondary structures near the ribosome binding site can impair translation initiation. Modification of the 5' untranslated region may improve expression.

  • Protein instability: The protein may be rapidly degraded. Co-expression of appropriate chaperones or growth at lower temperatures may improve stability.

  • Inefficient membrane insertion: The translocon machinery may be overwhelmed. Slower expression rates and/or co-expression of translocon components may help.

How can functional activity of purified YfbV be verified?

Since the specific function of YfbV remains undefined, researchers employ several approaches to verify that purified YfbV retains its native conformation and potential activity:

  • Structural integrity assessment:

    • Circular dichroism (CD) to confirm expected secondary structure content

    • Thermal stability assays to assess protein folding

    • Size exclusion chromatography to verify monodispersity

  • Ligand binding studies:

    • Thermal shift assays in presence of potential ligands

    • Isothermal titration calorimetry (ITC) with candidate interacting molecules

    • Surface plasmon resonance (SPR) with potential binding partners

  • Functional reconstitution:

    • Incorporation into liposomes or nanodiscs

    • Assessment of membrane integrity in reconstituted systems

    • Complementation assays in yfbV knockout strains

  • Protein-protein interaction studies:

    • Pull-down assays to identify interaction partners

    • Bacterial two-hybrid systems to assess protein interactions

    • Cross-linking studies to capture transient interactions

While the specific function of YfbV remains to be elucidated, these approaches provide valuable information about whether the purified protein maintains its native properties and potential functional capabilities.

How can E. coli strains be engineered for improved YfbV expression?

Engineering E. coli strains specifically for enhanced YfbV expression represents an advanced approach to overcoming expression limitations:

  • Genetic modifications:

    • Overexpression of translocon components (SecY, SecE, SecG)

    • Deletion of genes encoding proteases that might degrade YfbV

    • Modification of membrane lipid composition to better accommodate membrane proteins

  • Adaptive laboratory evolution:

    • Selection for strains that can tolerate higher levels of membrane protein expression

    • Isolation of variants with enhanced capacity for YfbV production

  • Synthetic biology approaches:

    • Creation of synthetic expression systems with fine-tuned control

    • Development of orthogonal translation systems dedicated to membrane protein production

Both selection-based and engineering-based approaches have been used to shape E. coli for recombinant membrane protein production . These approaches can potentially be applied to YfbV to further enhance production yields beyond what can be achieved through optimization of expression conditions alone.

What are the prospects for structural studies of YfbV?

The current AlphaFold prediction provides a starting point for understanding YfbV structure , but experimental structural studies would provide more definitive information:

  • X-ray crystallography challenges:

    • Requires large quantities of pure, homogeneous protein

    • Membrane proteins are difficult to crystallize

    • May require screening of hundreds of conditions

    • Often requires modification (e.g., removal of flexible regions)

  • Cryo-EM potential:

    • Less demanding in terms of protein quantity

    • Works well for membrane proteins in detergent micelles or nanodiscs

    • May be limited by the relatively small size of YfbV (151 aa)

    • Could be approached through fusion to a larger protein scaffold

  • NMR spectroscopy:

    • Suitable for smaller membrane proteins or domains

    • Provides dynamic information not available from static structures

    • Requires isotope labeling (15N, 13C, 2H)

    • Challenging in detergent environments

  • Hybrid approaches:

    • Combining experimental data (e.g., cross-linking, EPR) with computational modeling

    • Refining AlphaFold predictions with experimental constraints

The AlphaFold prediction already provides a good starting point with a global pLDDT score of 81.8 , but experimental validation and refinement would significantly advance our understanding of YfbV structure and potential function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.