Recombinant Escherichia coli O81 UPF0208 membrane protein YfbV (yfbV) is a protein expressed in an in vitro E. coli expression system . It is a membrane protein derived from Escherichia coli O81, strain ED1a . YfbV is also known under the synonyms yfbV, ECED1_2759, and UPF0208 membrane protein YfbV. The protein belongs to the UPF0208 family.
YfbV has a molecular weight of approximately 17 kDa . The full-length protein consists of 151 amino acids . The target protein sequence is: MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLCWQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVLAPVEGKPDYQALADTLKRAFKQLDKTFLDDL . The isoelectric point is 5.28 .
YfbV is annotated as a UPF0208 family protein, but its precise function remains largely unknown. As a membrane protein, it is likely located in the cell membrane.
Escherichia coli is a common host for recombinant membrane protein production, but it can be hampered by poor cellular accumulation and toxicity for the host . Optimization of gene overexpression and culturing conditions can maximize the accumulation of membrane-integrated and well-folded recombinant membrane proteins in E. coli strains .
Recombinant outer membrane proteins in E. coli can trigger considerable immune responses, making them potential candidates for vaccine development .
Recombinant YfbV may be used in various research applications, including:
KEGG: ecq:ECED1_2759
The function of YfbV remains largely uncharacterized, which is reflected in its UPF (Uncharacterized Protein Family) designation. The UPF0208 family comprises membrane proteins with unknown function. Based on its membrane localization and structural features, it may play roles in:
Membrane integrity or stability
Transport of small molecules
Signal transduction
Protein-protein interactions at the membrane interface
Researchers investigating this protein typically approach functional characterization through:
Comparative genomics with known membrane proteins
Gene knockout/complementation studies
Protein-protein interaction analyses
Transport assays if a transport function is suspected
E. coli remains the preferred expression system for YfbV, as demonstrated in multiple commercial and research preparations . The advantages of E. coli for YfbV expression include:
For YfbV specifically, E. coli has successfully been used with N-terminal His-tagging for purification purposes . The protein has been expressed in its full-length form (1-151 amino acids) with functional integrity.
Achieving high yields of soluble YfbV requires careful optimization of expression conditions. Based on general principles for membrane protein expression in E. coli and available data on YfbV:
| Parameter | Optimal Range | Effect on YfbV Expression |
|---|---|---|
| Temperature | 18-25°C | Lower temperatures reduce aggregation and increase proper folding |
| Inducer concentration | 0.1-0.5 mM IPTG | Lower concentrations prevent overwhelming the membrane insertion machinery |
| Induction time | 4-6 hours | Longer times may lead to degradation or reduced productivity |
| Media composition | LB with glycerol (0.5-2%) | Glycerol stabilizes membranes |
| Growth phase at induction | Mid-log phase (OD600 0.6-0.8) | Balances cell density and metabolic capacity |
Experimental design approaches using fractional factorial screening have proven effective for optimizing membrane protein expression parameters . Such approaches allow researchers to systematically evaluate multiple variables simultaneously, including media composition and induction conditions, to identify optimal expression parameters for YfbV.
Purification of His-tagged YfbV typically follows this protocol:
Membrane extraction: Cells are lysed and membranes isolated by ultracentrifugation
Solubilization: Membranes are treated with detergents (common choices include DDM, LDAO, or C12E8)
IMAC purification: The solubilized protein is purified using Ni-NTA or similar metal affinity resin
Size exclusion chromatography: Further purification to remove aggregates and contaminants
A typical purification workflow yields approximately 75-90% homogeneity, with yields of 5-10 mg/L culture for membrane proteins like YfbV . Storage in Tris/PBS-based buffer containing trehalose (6%) at pH 8.0 maintains stability, with recommended storage at -20°C/-80°C with 50% glycerol for long-term stability .
Membrane protein overexpression often triggers stress responses in E. coli, reducing yields and protein quality. Specific strategies to minimize stress during YfbV expression include:
| Stress Response | Mitigation Strategy | Molecular Mechanism |
|---|---|---|
| Membrane protein insertion stress | Lower induction temperature (18-22°C) | Reduces expression rate to match membrane insertion capacity |
| Reduced inducer concentration | Prevents overwhelming the translocon machinery | |
| Misfolded protein response | Co-expression of chaperones (DnaK/J, GroEL/ES) | Assists in proper folding |
| Addition of chemical chaperones (glycerol, sorbitol) | Stabilizes protein conformations | |
| Metabolic burden | Rich media with balanced carbon sources | Provides resources for both growth and protein production |
| Controlled feeding in fermentation | Maintains optimal nutrient levels |
Recent research has identified genes upregulated or downregulated during poor membrane protein insertion, providing potential targets for strain engineering . Successful overproduction of membrane proteins is directly linked to avoiding these stress responses in the host cell .
Characterizing the membrane integration of YfbV requires specialized analytical approaches:
Membrane fractionation: Separation of inner and outer membranes followed by western blotting to determine localization
Protease accessibility assays: Limited proteolysis of membrane vesicles to determine topology
Fluorescence-based approaches:
GFP fusion analysis to assess folding and membrane insertion
Site-specific fluorescent labeling to probe accessibility
Structural analysis:
Circular dichroism (CD) to assess secondary structure content
Limited proteolysis coupled with mass spectrometry to identify stable domains
Functional reconstitution: Incorporation into liposomes to assess functional activity if transport activity is suspected
The translocon machinery (SecYEG complex in E. coli) decides whether protein segments integrate into the membrane based on the hydrophobicity and charge distribution of the polypeptide . Understanding this process for YfbV specifically requires experimental validation using the methods above.
Several factors may contribute to poor YfbV expression even under seemingly optimized conditions:
Codon usage discrepancies: E. coli O81 may have different codon preferences than the expression host strain. Codon optimization or co-expression of rare tRNAs may help.
Toxicity: Overexpression may cause membrane stress or disrupt essential cellular processes. Strategies include:
Using tightly controlled inducible promoters
Expressing in C41/C43 strains specifically developed for toxic membrane proteins
Using Lemo21(DE3) strain with tunable expression level
mRNA secondary structure: Strong secondary structures near the ribosome binding site can impair translation initiation. Modification of the 5' untranslated region may improve expression.
Protein instability: The protein may be rapidly degraded. Co-expression of appropriate chaperones or growth at lower temperatures may improve stability.
Inefficient membrane insertion: The translocon machinery may be overwhelmed. Slower expression rates and/or co-expression of translocon components may help.
Since the specific function of YfbV remains undefined, researchers employ several approaches to verify that purified YfbV retains its native conformation and potential activity:
Structural integrity assessment:
Circular dichroism (CD) to confirm expected secondary structure content
Thermal stability assays to assess protein folding
Size exclusion chromatography to verify monodispersity
Ligand binding studies:
Thermal shift assays in presence of potential ligands
Isothermal titration calorimetry (ITC) with candidate interacting molecules
Surface plasmon resonance (SPR) with potential binding partners
Functional reconstitution:
Incorporation into liposomes or nanodiscs
Assessment of membrane integrity in reconstituted systems
Complementation assays in yfbV knockout strains
Protein-protein interaction studies:
Pull-down assays to identify interaction partners
Bacterial two-hybrid systems to assess protein interactions
Cross-linking studies to capture transient interactions
While the specific function of YfbV remains to be elucidated, these approaches provide valuable information about whether the purified protein maintains its native properties and potential functional capabilities.
Engineering E. coli strains specifically for enhanced YfbV expression represents an advanced approach to overcoming expression limitations:
Genetic modifications:
Overexpression of translocon components (SecY, SecE, SecG)
Deletion of genes encoding proteases that might degrade YfbV
Modification of membrane lipid composition to better accommodate membrane proteins
Adaptive laboratory evolution:
Selection for strains that can tolerate higher levels of membrane protein expression
Isolation of variants with enhanced capacity for YfbV production
Synthetic biology approaches:
Creation of synthetic expression systems with fine-tuned control
Development of orthogonal translation systems dedicated to membrane protein production
Both selection-based and engineering-based approaches have been used to shape E. coli for recombinant membrane protein production . These approaches can potentially be applied to YfbV to further enhance production yields beyond what can be achieved through optimization of expression conditions alone.
The current AlphaFold prediction provides a starting point for understanding YfbV structure , but experimental structural studies would provide more definitive information:
X-ray crystallography challenges:
Requires large quantities of pure, homogeneous protein
Membrane proteins are difficult to crystallize
May require screening of hundreds of conditions
Often requires modification (e.g., removal of flexible regions)
Cryo-EM potential:
Less demanding in terms of protein quantity
Works well for membrane proteins in detergent micelles or nanodiscs
May be limited by the relatively small size of YfbV (151 aa)
Could be approached through fusion to a larger protein scaffold
NMR spectroscopy:
Suitable for smaller membrane proteins or domains
Provides dynamic information not available from static structures
Requires isotope labeling (15N, 13C, 2H)
Challenging in detergent environments
Hybrid approaches:
Combining experimental data (e.g., cross-linking, EPR) with computational modeling
Refining AlphaFold predictions with experimental constraints
The AlphaFold prediction already provides a good starting point with a global pLDDT score of 81.8 , but experimental validation and refinement would significantly advance our understanding of YfbV structure and potential function.