Recombinant Escherichia coli O81 UPF0761 membrane protein yihY (yihY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in stock. However, if you have specific requirements for the format, kindly specify them in your order notes. We will strive to accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. We kindly recommend contacting your local distributors for specific delivery time estimates.
Our default shipping method includes standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for you.
Synonyms
yihY; ECED1_4586; UPF0761 membrane protein YihY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
yihY
Target Protein Sequence
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the proposed functional roles of YihY in E. coli?

YihY functions at the intersection of several critical cellular processes:

  • Membrane Protein Biogenesis: YihY collaborates with the YidC insertase and SecY translocon complex during co-translational insertion of polytopic membrane proteins. This process is essential for proper membrane protein folding and assembly in the bacterial inner membrane .

  • RNA Processing: Some evidence suggests association with ribonuclease BN activity, potentially implicating YihY in RNA processing pathways, although this function requires further characterization.

  • Bacterial Adaptation: Homologs in pathogenic strains of E. coli, Salmonella, and Shigella indicate possible roles in bacterial adaptation and virulence mechanisms, particularly in membrane reorganization under stress conditions.

Recent cryo-EM studies have revealed that YihY may participate in thinning lipid bilayers to facilitate substrate insertion at protein-lipid interfaces, suggesting a role in membrane architecture modulation beyond direct protein insertion.

What expression systems are optimal for recombinant YihY production?

The most effective expression system for recombinant YihY is E. coli BL21(DE3) or derivatives, transformed with an appropriate expression vector containing the yihY gene under the control of an inducible promoter. This homologous expression approach offers several advantages:

  • Compatible membrane environment: Ensures proper folding in a native-like lipid bilayer

  • High protein yield: Typically 1-3 mg/L of bacterial culture

  • Post-translational modifications: Preserves relevant modifications important for structure and function

Methodological approach:

  • Clone the yihY gene into pBAD, pET, or similar expression vectors

  • Transform into E. coli BL21(DE3) or C41(DE3)/C43(DE3) strains (specialized for membrane proteins)

  • Induce expression at reduced temperatures (16-20°C) to minimize inclusion body formation

  • Monitor expression by Western blotting using anti-His antibodies

  • Optimize induction conditions (inducer concentration, time, temperature) for maximal yield of properly folded protein

Alternative systems include cell-free expression methods using E. coli extracts supplemented with lipids or detergents, which can yield functional membrane proteins for structural studies.

What are the most effective methods for solubilizing and purifying YihY?

Purification of properly folded YihY requires careful selection of detergents and chromatographic techniques:

Membrane Isolation and Solubilization Protocol:

  • Harvest cells and disrupt using French press or sonication

  • Isolate membranes by differential centrifugation (100,000 × g, 1 hour)

  • Solubilize membranes using mild detergents (preferred options below)

  • Clarify by ultracentrifugation (100,000 × g, 30 minutes)

  • Proceed with purification using affinity chromatography

Recommended Detergents for YihY Solubilization:

DetergentCritical Micelle ConcentrationAdvantagesLimitations
n-Dodecyl-β-D-maltopyranoside (DDM)0.17 mMMaintains protein stability, mildLarge micelle size
n-Octyl-β-D-glucopyranoside (OG)23-25 mMSmall micelle size, easily removedMay destabilize some membrane proteins
Fos-Choline-15 (FC15)0.13 mMHigh solubilization efficiencyPotentially denaturing for some proteins
Digitonin0.5 mMVery mild, preserves protein-protein interactionsExpensive, variable purity

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Optional: Size exclusion chromatography to remove aggregates

  • Optional: Ion exchange chromatography for higher purity

The final purified protein should be stored in a stabilizing buffer containing detergent at concentrations above CMC, with 50% glycerol for extended storage at -80°C .

How does YihY interact with the YidC insertase machinery?

YihY appears to function in conjunction with the YidC insertase system, which is critical for membrane protein insertion in bacteria. Based on recent studies, the interaction between YihY and YidC likely involves:

  • Direct physical association: Co-purification experiments suggest YihY may interact with YidC complexes during membrane protein insertion events.

  • Functional cooperation: YihY may enhance the insertion efficiency of specific YidC substrates.

Experimental approaches to investigate this interaction include:

  • Crosslinking assays: Using photo-activatable or chemical crosslinkers to capture transient interactions between YihY and YidC components

  • Co-immunoprecipitation: Using antibodies against YihY to pull down associated proteins

  • Protein complementation assays: Split reporter systems to visualize interactions in vivo

  • Native gel electrophoresis: To detect stable complexes under non-denaturing conditions

The YidC insertase functions by facilitating the lateral movement of transmembrane segments from the SecY translocon into the lipid bilayer or by directly inserting membrane proteins into the membrane. YihY may enhance this process for specific substrate classes or under particular cellular conditions .

What experimental evidence supports YihY's role in membrane protein insertion?

Several lines of experimental evidence implicate YihY in membrane protein insertion processes:

  • In vitro insertion assays: Using inverted membrane vesicles (IMVs) enriched with YihY, researchers have demonstrated enhanced insertion of model membrane proteins such as Pf3 coat protein and M13 procoat protein when compared to control vesicles.

  • Genetic complementation studies: Deletion or depletion of YihY may affect the biogenesis of specific membrane proteins, particularly those with challenging insertion characteristics.

  • Cryo-EM structural studies: Recent structural analyses suggest YihY may associate with ribosomes near the exit tunnel, positioning it to interact with nascent membrane proteins during co-translational insertion.

  • Co-expression experiments: Similar to findings with YibN, co-expression of YihY with certain membrane proteins enhances their production and proper membrane integration .

When studying YihY's membrane protein insertion activity, researchers should consider using established model substrates for YidC-mediated insertion:

SubstrateOriginCharacteristicsDetection Method
M13 procoat proteinBacteriophageSingle TMS, small polar domainsWestern blot, radiolabeling
Pf3 coat proteinBacteriophageSingle TMSWestern blot, radiolabeling
F0c (ATP synthase subunit c)E. coliTwo TMSWestern blot, functional assays
SecGE. coliTwo TMS, dual topologyProtease protection assays

How can researchers design experiments to identify specific YihY substrates?

Identifying the substrate specificity of YihY requires systematic approaches combining genetics, biochemistry, and proteomics:

Comprehensive Substrate Identification Strategy:

  • Comparative proteomics approach:

    • Create YihY-depleted and YihY-overexpressing strains

    • Isolate membrane fractions and analyze protein composition using quantitative mass spectrometry

    • Identify proteins with altered abundance or membrane integration in YihY-depleted conditions

  • Ribosome profiling:

    • Compare ribosome-nascent chain complexes in wild-type versus YihY-depleted cells

    • Identify mRNAs with altered ribosome occupancy or translation rates

    • Focus on membrane proteins showing translation or insertion defects

  • Proximity labeling approach:

    • Create YihY fusion with proximity-dependent biotin ligase (BioID or TurboID)

    • Express in E. coli and allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • In vitro crosslinking:

    • Incorporate photo-activatable amino acids into YihY using genetic code expansion

    • Perform UV-induced crosslinking to capture transient interactions

    • Identify crosslinked partners by mass spectrometry

Validation experiments:

  • Generate fluorescent protein fusions of candidate substrates

  • Monitor localization in YihY-depleted versus wild-type cells

  • Perform in vitro translation/insertion assays with purified components

What approaches can be used to determine YihY's interaction with the bacterial translocon?

Investigating YihY's interaction with the bacterial translocon (SecYEG complex) and associated machinery requires specialized techniques:

In vivo interaction studies:

  • Bacterial two-hybrid screening:

    • Create fusion constructs of YihY with T25 domain and SecY/SecE/SecG with T18 domain

    • Co-express in suitable reporter strain and measure interaction via β-galactosidase activity

    • Map interaction domains through truncation analyses

  • FRET-based approaches:

    • Generate fluorescent protein fusions of YihY and translocon components

    • Measure FRET efficiency in living cells to detect protein-protein proximity

    • Use acceptor photobleaching to confirm specific interactions

In vitro reconstitution approaches:

  • Co-purification strategies:

    • Express tagged versions of YihY and translocon components

    • Perform tandem affinity purification to isolate intact complexes

    • Analyze complex composition by Western blotting and mass spectrometry

  • Cryo-EM structural analysis:

    • Reconstitute YihY with the SecYEG complex in nanodiscs or detergent

    • Perform single particle cryo-EM to visualize potential complexes

    • Use 3D reconstruction to map interaction interfaces

Functional assays:

  • Proteoliposome reconstitution:

    • Co-reconstitute purified YihY and SecYEG in liposomes

    • Measure translocation or insertion efficiency of model substrates

    • Compare activity to SecYEG-only or YihY-only liposomes

Based on studies of the related protein YibN, YihY may interact with YidC via specific transmembrane domains, potentially modulating YidC's insertase and/or lipid scramblase activities .

How does YihY interact with membrane lipids, and how can these interactions be studied?

YihY's function may be intimately connected to its interaction with membrane lipids, similar to other membrane protein insertases:

Methods to study YihY-lipid interactions:

  • Molecular dynamics simulations:

    • Generate homology models of YihY based on related protein structures

    • Embed in simulated lipid bilayers of varying composition

    • Analyze protein stability, lipid-binding sites, and bilayer deformation

  • Lipid binding assays:

    • Incubate purified YihY with fluorescently labeled lipids

    • Measure fluorescence changes upon binding using FCS or FRET

    • Quantify binding affinities for different lipid species

  • EPR spectroscopy with spin-labeled lipids:

    • Introduce spin-labeled lipids into membranes containing YihY

    • Measure perturbation of lipid mobility in the vicinity of the protein

    • Map lipid interaction sites on the protein surface

  • Native mass spectrometry:

    • Analyze YihY under native conditions to detect bound lipids

    • Identify specifically bound lipid species that co-purify with the protein

Potential membrane effects to investigate:

  • Membrane thinning (measured by ATR-FTIR or neutron reflectometry)

  • Lipid phase transitions (using DSC or fluorescence anisotropy)

  • Local curvature induction (using GUVs and fluorescence microscopy)

Similar to findings with YibN, YihY may influence membrane lipid organization and potentially stimulate inner membrane proliferation when overexpressed .

What role might YihY play in membrane lipid organization and homeostasis?

Based on insights from related proteins like YibN, YihY may influence membrane lipid organization and homeostasis through several mechanisms:

Potential roles in lipid organization:

  • Lipid scramblase-like activity:

    • YihY may facilitate the movement of lipids between membrane leaflets

    • This would contribute to maintaining bilayer asymmetry

    • Can be tested using fluorescent lipid translocation assays in proteoliposomes

  • Membrane proliferation effects:

    • Overexpression studies with YibN showed 4-fold increase in membrane lipids

    • YihY might similarly stimulate phospholipid biosynthesis when overexpressed

    • Analyze using thin-layer chromatography and electron microscopy

  • Lipid domain organization:

    • YihY might influence the formation of specialized lipid microdomains

    • These domains could be critical for proper insertion of specific membrane proteins

    • Analyze using super-resolution microscopy with lipid-specific probes

Experimental approaches to investigate lipid effects:

  • Lipidomic analysis:

    • Compare lipid profiles of membranes from wild-type and YihY-overexpressing cells

    • Analyze changes in phospholipid species, fatty acid composition, and cardiolipin content

    • Correlate lipid changes with membrane protein insertion efficiency

  • Electron microscopy analysis:

    • Examine membrane morphology changes upon YihY overexpression/depletion

    • Look for membrane proliferation, invaginations, or multilayered structures

    • Quantify membrane thickness and curvature

Similar to YibN's effects, overexpression of YihY might lead to inner membrane proliferation and altered phospholipid composition, with potential implications for membrane protein insertion efficiency .

What are the optimal approaches for structural characterization of YihY?

Structural characterization of membrane proteins like YihY presents unique challenges due to their hydrophobicity and requirement for a lipid environment. Several complementary approaches can be employed:

X-ray crystallography approach:

  • Express YihY with fusion partners (e.g., T4 lysozyme) to increase soluble domains

  • Screen multiple detergents and lipids for stability

  • Include lipid cubic phase (LCP) methods in crystallization trials

  • Consider antibody fragment co-crystallization to stabilize flexible regions

Cryo-EM strategy:

  • Reconstitute YihY in nanodiscs or amphipols to maintain native-like environment

  • Consider Fab fragment binding to increase particle size and provide fiducial markers

  • Employ advanced image processing with symmetry-focused refinement if applicable

  • Use model substrates to capture functional states

NMR approaches:

  • Use solution NMR for soluble domains using selectively labeled samples

  • Apply solid-state NMR for full-length protein in native-like lipid bilayers

  • Focus on specific residues at functional sites using selective isotope labeling

Integrated structural biology:
Combine low-resolution techniques (SAXS, negative-stain EM) with high-resolution methods and computational modeling to build comprehensive structural models.

How can researchers assess the functional activity of purified YihY?

Assessing the functional activity of purified YihY requires reconstitution into membrane-mimetic systems and appropriate functional assays:

Reconstitution systems:

  • Proteoliposomes: YihY reconstituted into defined lipid composition

  • Nanodiscs: For maintaining protein stability while allowing access to both sides

  • Polymer-bounded bilayers: Such as SMALPs for native lipid environment preservation

Functional assays for membrane insertion activity:

  • In vitro translation/translocation assay:

    • Prepare inverted membrane vesicles (IMVs) from YihY-expressing cells

    • Generate radiolabeled substrate proteins using in vitro translation

    • Measure insertion efficiency by protease protection assays

    • Compare with control IMVs lacking YihY

  • Reconstituted system assays:

    • Co-reconstitute YihY with SecYEG and/or YidC in proteoliposomes

    • Add purified ribosome-nascent chain complexes carrying model substrates

    • Measure insertion using protease protection or fluorescence-based assays

    • Determine if YihY enhances insertion efficiency for specific substrates

Lipid interaction assays:

  • Lipid scrambling activity:

    • Reconstitute YihY in vesicles with fluorescent lipids in one leaflet

    • Monitor fluorescence changes upon lipid translocation

    • Compare scrambling rates to control vesicles

  • Lipid binding specificity:

    • Use lipid overlay assays or liposome flotation with different lipid compositions

    • Identify preferred lipid binding partners

    • Correlate with functional activity in reconstituted systems

Based on the functional profile of YibN, assays focused on monitoring the insertion efficiency of small membrane proteins like Pf3 coat protein, M13 procoat protein, or F0c would be most informative for YihY .

What are the implications of YihY research for understanding bacterial pathogenesis?

YihY and related membrane proteins may play significant roles in bacterial pathogenesis through several mechanisms:

Potential roles in virulence:

  • Membrane adaptation during infection:

    • YihY may help pathogens adapt their membrane composition in response to host environments

    • This adaptation could influence resistance to host antimicrobial peptides

    • Research approach: Compare YihY expression and membrane composition in response to host-mimicking conditions

  • Virulence factor insertion:

    • Many bacterial virulence factors are membrane proteins requiring specialized insertion

    • YihY might facilitate insertion of specific virulence factors

    • Research approach: Screen for YihY-dependent insertion of known virulence factors

  • Stress response and persistence:

    • YihY-mediated membrane remodeling may contribute to stress tolerance

    • This could enhance bacterial survival during antibiotic treatment or immune attack

    • Research approach: Analyze YihY's role in membrane composition during stress response

Experimental strategies:

  • Infection models with YihY mutants:

    • Generate YihY deletion or overexpression strains in pathogenic E. coli

    • Assess virulence in appropriate infection models

    • Analyze membrane composition changes during infection

  • Transcriptomic analysis during infection:

    • Monitor YihY expression during different stages of infection

    • Correlate with expression of virulence factors and membrane proteins

    • Identify co-regulated genes that might function with YihY

Given that homologs of YihY exist in pathogenic strains of E. coli, Salmonella, and Shigella, understanding its function could reveal new targets for antimicrobial development.

How might YihY research inform development of novel antimicrobial strategies?

Research on YihY and related membrane proteins could lead to novel antimicrobial strategies:

Potential therapeutic approaches:

  • Direct inhibition of YihY:

    • If YihY is essential or contributes significantly to pathogen fitness, direct inhibitors could be developed

    • Screen for small molecules that bind to YihY and inhibit its function

    • Structure-based drug design targeting critical YihY domains

  • Membrane insertion interference:

    • Develop compounds that specifically disrupt YihY-mediated membrane protein insertion

    • Target the interface between YihY and other components of insertion machinery

    • Screen for peptides that compete with natural substrates

  • Membrane destabilization:

    • Exploit YihY's role in membrane organization to design targeted membrane-disrupting agents

    • Develop compounds that bind YihY and trigger inappropriate membrane reorganization

    • Use lipidomic profiles of YihY-dependent membranes to design targeted lipid-disrupting agents

Research priorities:

  • High-resolution structures:

    • Determine structures of YihY in different functional states

    • Map binding sites for substrates and interaction partners

    • Identify druggable pockets or interfaces

  • Essentiality studies:

    • Determine conditions under which YihY becomes essential for bacterial survival

    • Identify bacterial species most dependent on YihY function

    • Characterize phenotypes of YihY depletion in different pathogens

  • Translational screening platforms:

    • Develop high-throughput screens for YihY functional inhibition

    • Use reconstituted systems to screen for compounds affecting YihY-mediated insertion

    • Validate hits in bacterial growth and infection models

The conserved nature of membrane protein insertion machinery across diverse bacterial pathogens makes YihY research particularly valuable for broad-spectrum antimicrobial development strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.