Recombinant Escherichia coli O81 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O81 Zinc Transport Protein ZntB (zntB)

The ZntB protein is a zinc transporter found in Escherichia coli and other Enterobacteria, playing a crucial role in maintaining zinc homeostasis within the cell . ZntB functions as a Zn2+^{2+} efflux system, removing excess zinc from the cytoplasm to prevent toxicity . Recombinant ZntB refers to the protein produced using recombinant DNA technology in a host organism, often E. coli, to facilitate research and application .

Structure and Function of ZntB

ZntB is a transmembrane protein that facilitates the export of Zn2+^{2+} ions across the cell membrane . Structural studies using X-ray crystallography have revealed key features of ZntB . The cytoplasmic domains of ZntB from Salmonella enterica serovar Typhimurium (StZntB) form a funnel-like structure, similar to the CorA Mg2+^{2+} channel from Thermotoga maritima . This structure includes a central α7 helix that, in StZntB, is oriented perpendicular to the membrane, creating a cylindrical pore that may represent an open state of the channel .

Recombinant Production of ZntB

Recombinant ZntB can be produced in various expression systems, including E. coli, yeast, baculovirus, and mammalian cells . E. coli strains such as BL21(DE3) are commonly used for recombinant protein expression due to their genetic characteristics, such as deficiencies in Lon protease and OmpT protease, which can degrade foreign proteins . The BL21(DE3) strain contains a λDE3 prophage with the T7 RNAP gene under the lacUV5 promoter, allowing for controlled expression of the target gene .

Methods for Recombinant Protein Expression in E. coli

Several strategies can optimize recombinant protein expression in E. coli :

  • Strain Selection: Choosing the appropriate E. coli strain is crucial. For example, strains like C41(DE3) and C43(DE3) are designed to withstand the expression of toxic proteins .

  • Secretion Strategies: Secreting the recombinant protein to the periplasm or the medium can sometimes be the only way to produce a recombinant protein . Signal peptides such as Lpp, LamB, OmpA, OmpC, OmpF and OmpT can be used for secretion .

  • Disulfide Bond Formation: For proteins requiring disulfide bonds, strains like Origami™ and SHuffle® are engineered to provide an oxidative cytoplasmic environment that favors disulfide bond formation .

Applications of Recombinant ZntB

Recombinant ZntB is valuable for:

  • Structural Studies: Providing sufficient quantities of the protein for structural determination using techniques like X-ray crystallography .

  • Functional Studies: Enabling detailed investigation of zinc transport mechanisms and regulation .

  • Biotechnology: Applications in biosensors for detecting zinc and in bioremediation to remove zinc from contaminated environments.

Tables

FeatureDescription
Protein NameRecombinant Escherichia coli O81 Zinc transport protein ZntB (zntB)
FunctionZn2+^{2+} efflux system, maintains zinc homeostasis
Source OrganismEscherichia coli
Expression SystemsE. coli, Yeast, Baculovirus, Mammalian cells
Common Expression StrainsBL21(DE3), C41(DE3), C43(DE3)
Structural FeaturesFunnel-like structure with a central α7 helix
ApplicationsStructural studies, functional studies, biotechnology (biosensors, bioremediation)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
zntB; ECED1_1552; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function
Mediates zinc ion efflux.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and what is its primary function in bacterial systems?

ZntB is a membrane protein belonging to the 2-TM-GxN family of transporters that mediates zinc transport across bacterial membranes. Contrary to earlier hypotheses suggesting it functioned primarily as an exporter, recent research demonstrates that ZntB primarily mediates zinc uptake into bacterial cells, particularly in Enterobacteriaceae . The protein forms a funnel-shaped homopentameric structure that creates a pore through the membrane, allowing for the regulated transport of zinc ions . Studies using isothermal titration calorimetry (ITC), radioactive uptake assays, and fluorescent transport experiments with ZntB reconstituted into liposomes have confirmed its role in zinc uptake, which is notably stimulated by proton gradients across the membrane .

How does ZntB differ structurally from other metal transporters?

  • Unlike CorA, which has a V-shaped funnel that narrows near the membrane, the StZntB (Salmonella Typhimurium ZntB) funnel is cylindrical with a larger diameter (approximately 12 Å) near the membrane, suggesting an "open" conformation .

  • The central α7 helix forming the inner wall of the StZntB funnel is oriented perpendicular to the membrane, unlike the marked angle seen in CorA or VpZntB (Vibrio parahemolyticus ZntB) .

  • ZntB homopentamer is stabilized by extensive salt-bridges between monomers, whereas the CorA homopentamer is partially stabilized by Mg²⁺ ions within the cytosolic domain .

  • VpZntB has a short α-helix (α6b) between and at right angles to α6 and α7 at the mouth of the funnel that is not present in StZntB or CorA .

What research methods have been employed to characterize ZntB structure?

Scientists have used multiple complementary techniques to elucidate ZntB structure:

  • X-ray crystallography was used to determine the crystal structures of cytoplasmic domains from ZntB homologues at high resolution (1.9 Å for VpZntB) .

  • Cryo-electron microscopy (cryo-EM) was employed to solve the full-length structure of ZntB from Escherichia coli, as reported by Gati et al. in their 2017 Nature Communications publication .

  • Anomalous diffraction techniques helped identify bound ions in the crystal structures, distinguishing between zinc, chloride, and other ions .

  • Isothermal titration calorimetry (ITC) was used to measure zinc binding capacity of both the soluble domain and full-length transporter .

  • Electrostatic analysis aided in understanding how chloride ions might tune the properties of the funnel to favor zinc passage .

How are recombinant ZntB proteins typically expressed and purified for structural studies?

Expression and purification of recombinant ZntB typically follows these methodological steps:

  • Expression system selection: E. coli is the preferred expression system, with strains like BL21(DE3) commonly used for membrane protein expression. For challenging or toxic proteins, specialized strains such as C41(DE3) or C43(DE3) may be employed .

  • Vector construction: The zntB gene is typically cloned into expression vectors containing inducible promoters (such as T7) and appropriate tags for purification. Common tags include His-tags for affinity purification .

  • Membrane protein expression strategy: For proper membrane insertion, several approaches can be used:

    • Sec-dependent pathway for post-translational translocation to the periplasm

    • SRP (signal recognition particle) pathway for co-translational translocation

    • Direct cytoplasmic expression with subsequent membrane extraction

  • Purification protocol:

    • Cell lysis often using detergents to solubilize membrane proteins

    • Affinity chromatography using the engineered tags

    • Size exclusion chromatography to isolate the pentameric ZntB complex

    • For structural studies, maintaining ZntB in appropriate detergent micelles or reconstitution into nanodiscs or liposomes

Recombinant ZntB is typically prepared in storage buffers containing 50% glycerol in a Tris-based buffer system and can be stored at -20°C for extended periods, though repeated freeze-thaw cycles are not recommended .

What experimental systems have been used to measure ZntB-mediated zinc transport?

Researchers have employed several complementary experimental systems to characterize ZntB transport mechanisms:

  • Radioisotope uptake assays: Using ⁶⁵ZnCl₂ to directly track zinc movement across membranes. The standard protocol involves:

    • Growing bacterial cells to mid-log phase (OD₆₀₀ of 0.4)

    • Washing cells to remove external zinc

    • Incubating with radiolabeled zinc

    • Filtering cells and measuring radioactivity via gamma counting

  • Fluorescent transport assays: Using zinc-sensitive fluorophores to monitor zinc movement in real-time across proteoliposomes at different pH conditions .

  • Isothermal titration calorimetry (ITC): To determine binding constants (Kd values) for zinc and other divalent cations (Cd²⁺, Ni²⁺, Co²⁺) .

  • Growth phenotype analysis: Testing zinc sensitivity via:

    • Disk diffusion assays using filter disks containing toxic levels of zinc salts

    • Growth curve analysis in minimal media containing various ZnSO₄ concentrations

  • ZntB reconstitution into liposomes: Incorporating purified ZntB into artificial membrane systems to study transport in isolation from other cellular components .

How does the zntB gene's expression respond to changing zinc concentrations?

The expression of zntB is tightly regulated as part of bacterial zinc homeostasis mechanisms:

What is the current understanding of the zinc transport mechanism in ZntB?

The zinc transport mechanism in ZntB has been clarified through recent structural and functional studies:

  • Proton-coupled transport: Multiple lines of evidence now indicate ZntB functions as a proton-driven zinc importer rather than an exporter:

    • Radioactive uptake assays show enhanced zinc transport in the presence of pH gradients

    • Fluorescent transport assays demonstrate that zinc uptake is stimulated by proton gradients across the membrane

    • The transport mechanism differs significantly from that proposed for homologous CorA channels

  • Transport directionality: Studies using both full-length structures and biochemical assays have resolved the previous contradiction about ZntB's directionality:

    • Earlier assumptions based on homology with CorA suggested an export function

    • In Salmonella enterica, ZntB was initially characterized as contributing to zinc efflux

    • Recent definitive work with E. coli ZntB reconstituted into liposomes confirms its primary role in zinc uptake

  • Ion selectivity mechanism: The structure reveals specific features enabling zinc selectivity:

    • Chloride ions tune the electrostatic properties of the funnel, neutralizing positively-charged amino acids to favor zinc passage over monovalent ions

    • Two rings of acidic amino acids at the funnel base may strip water molecules from zinc ions before transport

    • The cylindrical pore shape (versus the conical shape in CorA) may reflect an "open" transport-competent state

  • Multiple zinc binding sites: Structural and ITC studies have identified three distinct zinc binding sites in ZntB:

    • The first involving coordinating histidines (possibly non-physiological)

    • A second site on the funnel surface involving cysteine and histidine residues

    • A third site within the pentamer wall coordinated by histidine and cysteine residues

How do mutations in key ZntB residues affect zinc transport and binding?

Mutagenesis studies have identified several critical residues involved in ZntB function:

  • Proton binding residues: Mutations in specific amino acids affect the proton coupling mechanism:

    • Amino acids involved in proton binding are critical for the proton-coupled transport mechanism

    • When these residues are mutated, the ability of proton gradients to drive zinc transport is significantly impaired

  • Zinc coordination sites: The function of zinc binding sites varies:

    • Some residues are crucial for the transport mechanism itself

    • Others appear less critical for zinc ion recognition but may play structural roles

    • Specific histidine and cysteine residues (H41, C94, H159, H168, C246) coordinate zinc ions in different regions of the protein

  • Transmembrane helix residues: The C-terminal stalk helix (α7) that forms a transmembrane segment is particularly important:

    • It starts in the cytoplasm and extends toward the cell membrane

    • In full-length StZntB, this segment is predicted to be a transmembrane helix as in CorA

    • The three anti-parallel α-helices (α5, α6, and α7) form a coiled-coil domain with heptad sequence repeats promoting hydrophobic interactions that are essential for structure stability

  • Signature motif significance: Different ZntB homologs contain distinct signature motifs that affect function:

    • Standard ZntB proteins contain the GxxGVNxGGxP motif

    • Agrobacterium tumefaciens ZntB has a variant GxxGMNxxDExP motif and shows different metal transport properties, highlighting the importance of this region

How do homologs of ZntB from different bacterial species compare functionally?

ZntB homologs show interesting functional variations across bacterial species:

  • E. coli ZntB (EcZntB): Definitively shown to function as a proton-gradient driven zinc importer. The full-length structure reveals that it maintains its pentameric structure even in the absence of substrate, unlike related transporters .

  • Salmonella enterica ZntB (StZntB): Initially characterized as a zinc efflux pathway based on zinc sensitivity phenotypes of mutants. Crystal structures of its cytoplasmic domain revealed three zinc binding sites per monomer and a distinctive cylindrical funnel pore that differs from related transporters .

  • Vibrio parahemolyticus ZntB (VpZntB): Structural studies of its cytoplasmic domain revealed binding of chloride ions rather than zinc or magnesium, despite crystallization in the presence of MgCl₂. Shows a conical funnel shape more similar to CorA than to StZntB .

  • Agrobacterium tumefaciens ZntB (AtZntB): Shows significant sequence divergence with under 20% amino acid identity to StZntB and a variant signature motif (GxxGMNxxDExP versus GxxGVNxGGxP). Not involved in resistance to various metals (Zn²⁺, Cd²⁺, Co²⁺, Cu²⁺, Fe²⁺, Mg²⁺, Mn²⁺, Ni²⁺, Pb²⁺), suggesting it may function as a metal importer with different specificity compared to other ZntB proteins .

The functional variations correlate with structural differences, particularly in the cytoplasmic domain organization and the shape of the transport pore, highlighting evolutionary adaptations to different bacterial zinc requirements.

What techniques can be used to create and validate E. coli zntB knockout mutants for functional studies?

Creating precise zntB knockout mutants in E. coli requires specialized techniques:

  • Lambda Red recombination system: The most efficient method for targeted gene deletion:

    • Requires only 35-50 bp of homology flanking the target gene

    • Uses three phage λ proteins: Gam (inhibits RecBCD exonuclease), Beta (single-strand DNA binding), and Exo (5'→3' exonuclease)

    • PCR products containing antibiotic resistance cassettes flanked by homology regions are transformed into cells expressing λ Red proteins

  • Keio collection approach: The established methodology used to create the Keio collection of E. coli single-gene knockouts:

    • Employs precise in-frame deletions to minimize polar effects on adjacent genes

    • Includes FRT (FLP recombination target) sites flanking the antibiotic marker for subsequent removal

    • The methodology successfully deleted 3985 non-essential E. coli genes, including zntB

  • Validation methods:

    • PCR verification of gene deletion using primers flanking the targeted region

    • DNA sequencing to confirm precise deletion boundaries

    • Phenotypic assays to confirm expected zinc-related phenotypes

    • Complementation tests using plasmid-expressed zntB to rescue mutant phenotypes

  • Considerations for essential gene analysis:

    • False negative results may occur if suppressors arise during selection

    • Some genes may be "quasi-essential," where deletions can be obtained only when suppressors arise

    • Confirming gene essentiality requires multiple independent attempts at deletion

    • Conditional knockout approaches may be needed for essential genes

For zntB specifically, knockout mutants have been successfully generated, confirming it is non-essential under standard laboratory conditions while exhibiting altered zinc sensitivity phenotypes .

What structural features distinguish the cytoplasmic domain from the transmembrane region of ZntB?

ZntB has distinct structural domains with specific features:

  • Cytoplasmic domain:

    • Comprises an αβα sandwich fold followed by a long stalk helix

    • Forms a funnel-shaped homopentamer when assembled

    • Contains multiple zinc binding sites identified through crystallography

    • In StZntB, this domain includes three zinc binding sites per monomer:

      • First site: coordinated by two adjacent H41 residues (possibly non-physiological)

      • Second site: on the funnel surface, coordinated by C94 and H159

      • Third site: within the pentamer wall, coordinated by H168 and C246

    • In VpZntB, chloride ions rather than metal cations were found bound to the cytoplasmic domain (five Cl⁻ ions per monomer)

  • Transmembrane region:

    • Consists primarily of two transmembrane helices per monomer

    • The C-terminal stalk helix (α7) forms one of these transmembrane segments

    • The five transmembrane domains from the pentamer create the ion conduction pathway

    • Contains residues critical for proton coupling and zinc transport

    • Forms a pore that varies between cylindrical (in StZntB, suggesting an "open" conformation) and conical (in VpZntB and CorA, suggesting a "closed" state)

  • Interface region:

    • The base of the cytoplasmic funnel contains two rings of acidic amino acids that may play a role in removing water molecules from zinc ions before transport

    • This region is critical for ion selectivity, distinguishing between zinc and other ions

    • Structural changes in this region likely couple conformational changes between the cytoplasmic and transmembrane domains during transport

The full-length cryo-EM structure of E. coli ZntB (PDB: 5n9y) has provided the most complete picture of how these domains function together in the intact transporter .

How does the research on ZntB contribute to broader understanding of metal homeostasis in pathogenic bacteria?

ZntB research has significant implications for understanding bacterial metal homeostasis and pathogenesis:

  • Zinc as a virulence factor:

    • In Enterobacteriaceae, several membrane transporters involved in zinc homeostasis are linked to virulence

    • Host organisms attempt to sequester zinc at host-pathogen interfaces to reduce bacterial virulence

    • Pathogens employ specific zinc uptake systems to counteract this sequestration

    • When hosts elevate zinc to toxic levels, bacteria upregulate export mechanisms

  • Coordination of zinc import-export systems:

    • E. coli employs a controlled balance of zinc transport systems:

      • ZupT (ZIP family) for import

      • ZntA for export

      • ZntB for import (driven by proton gradients)

      • ZnuABC system for high-affinity import

    • These systems respond differentially to zinc availability

    • DNA microarray studies show that excess zinc induces cysteine biosynthesis genes, suggesting cysteine plays a role in zinc sequestration

  • Stress response integration:

    • Zinc stress activates the RpoE regulon and other genes for protein repair

    • This suggests that periplasmic proteins denatured by zinc trigger cellular repair mechanisms

    • Understanding these pathways provides insight into bacterial adaptation to host environments

  • Evolution of transport mechanisms:

    • ZntB represents an interesting case where a member of the 2-TM-GxN family evolved as a transporter rather than a channel

    • This parallels the ClC protein family, which includes both channels and transporters

    • This evolutionary flexibility highlights how bacteria adapt to varying environmental conditions and metal availability

Understanding ZntB and related metal transporters may provide targets for novel antimicrobial strategies that disrupt metal homeostasis in pathogenic bacteria.

Data Table 1: Comparison of ZntB Homologs from Different Bacterial Species

SpeciesPDB IDStructure DeterminedFunctionKey FeaturesSignature Motif
E. coli5n9yFull-length, cryo-EMProton-driven Zn²⁺ importerMaintains pentameric structure without substrate; transport stimulated by pH gradientGxxGVNxGGxP
Salmonella Typhimurium3ck6Cytoplasmic domain, X-rayInitially characterized as Zn²⁺ exporter; recent evidence suggests import functionCylindrical funnel pore (12 Å diameter); three Zn²⁺ binding sites per monomerGxxGVNxGGxP
Vibrio parahemolyticusNot specifiedCytoplasmic domain, X-ray (1.9 Å)Not definitively establishedConical funnel shape; binds Cl⁻ ions rather than Zn²⁺ or Mg²⁺GxxGVNxGGxP
Agrobacterium tumefaciensNot availableNot determinedPossible metal importer with different specificity<20% amino acid identity with StZntB; not involved in resistance to various metalsGxxGMNxxDExP

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.