Recombinant Escherichia coli O81 Zinc transporter ZupT (zupT)

Shipped with Ice Packs
In Stock

Description

Role in Zinc Transport

ZupT is a low-affinity, high-capacity transporter critical for zinc acquisition under metal-limiting conditions. Key findings include:

  • Broad Substrate Specificity: ZupT transports Zn²⁺, Fe²⁺, Mn²⁺, and Co²⁺, with zinc uptake confirmed via ⁶⁵Zn²⁺ radiolabel assays .

  • Redundant Transport Systems: In E. coli, ZupT operates alongside the high-affinity ATP-binding cassette (ABC) transporter ZnuABC. While ZnuABC dominates under severe zinc limitation, ZupT provides backup uptake .

  • Constitutive Expression: Unlike ZnuABC, ZupT is not regulated by zinc availability and is expressed at low baseline levels .

Pathogenicity and Stress Resistance

In uropathogenic E. coli (UPEC) CFT073, ZupT contributes to:

  • Oxidative Stress Resistance: Zinc acquired via ZupT enhances catalase activity, mitigating hydrogen peroxide toxicity .

  • Motility: Zinc deficiency in ΔzupT mutants reduces flagellar function, impairing motility .

Applications in Research

Recombinant ZupT is utilized to:

  1. Study Metal Transport Mechanisms: Overexpression in transporter-deficient E. coli strains (e.g., ΔznuABC ΔzupT) confirms its role in ⁶⁵Zn²⁺ uptake .

  2. Characterize ZIP Family Dynamics: Comparative studies with eukaryotic ZIP homologs (e.g., Arabidopsis ZIP1) reveal evolutionary conservation in metal transport .

  3. Investigate Pathogen Fitness: Deletion mutants (e.g., UPEC ΔzupT) show attenuated virulence in murine urinary tract infection models, highlighting zinc’s role in bacterial survival .

Comparative Analysis with Other Transporters

FeatureZupT (ZIP Family)ZnuABC (ABC Family)
AffinityLow-affinityHigh-affinity
Energy SourceChemiosmotic gradientATP hydrolysis
RegulationConstitutiveZur-regulated
SubstrateZn²⁺, Fe²⁺, Mn²⁺, Co²⁺ Zn²⁺-specific
Pathogenic RoleSupports oxidative stress resistance Critical for kidney colonization in UPEC

Future Directions

Research gaps include elucidating ZupT’s structural architecture and its interplay with metallochaperones. Engineering ZupT variants with altered metal specificity could advance bioremediation or antimicrobial strategies targeting bacterial metal uptake .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly specify them in your order remarks, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
zupT; ECED1_3708; Zinc transporter ZupT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Escherichia coli O81 (strain ED1a)
Target Names
zupT
Target Protein Sequence
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTVGIG
Uniprot No.

Target Background

Function
Mediates zinc uptake. May also transport other divalent cations.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, ZupT subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular function of ZupT in E. coli?

ZupT functions as a divalent metal cation transporter with broad substrate specificity. Initially identified as a zinc transporter, research has demonstrated that ZupT facilitates the uptake of multiple divalent metal ions including zinc, iron, and cobalt . Unlike the ZnuACB system which uses ATP hydrolysis for transport, ZupT is thought to require a chemo-osmotic gradient for metal translocation across the membrane . ZupT belongs to the ZIP family of transporters, which are more commonly found in eukaryotes, making it an interesting subject for studying evolutionary relationships between prokaryotic and eukaryotic metal transport systems .

Experimental verification of ZupT's transport activity typically involves:

  • Radioactive metal uptake assays using isotopes such as ⁶⁵Zn²⁺ and ⁵⁷Co²⁺

  • Growth complementation studies in strains lacking other metal transport systems

  • Heterologous expression in various bacterial backgrounds

How does ZupT compare to other zinc transporters in E. coli?

ZupT is one of several zinc transporters in E. coli, with distinct characteristics compared to the high-affinity ZnuACB system:

FeatureZupTZnuACBSitABCD
Transport familyZIP familyABC transporterABC transporter
Energy sourceChemo-osmotic gradientATP hydrolysisATP hydrolysis
Metal specificityBroad (Zn²⁺, Fe²⁺, Mn²⁺, Co²⁺)Zinc-specificPrimarily Mn²⁺, can transport Zn²⁺
Relative zinc affinityLowerHigherLowest
Contribution to zinc uptakeSecondaryPrimaryMinimal
RegulationLess zinc-responsiveTightly regulated by ZurRegulated by MntR and Fur

Comparative studies demonstrate that ZnuACB is the predominant zinc transporter in uropathogenic E. coli (UPEC) strain CFT073, as evidenced by the greater decrease in ⁶⁵Zn²⁺ accumulation in Δznu mutants compared to ΔzupT mutants . When expressed from medium-copy-number plasmids, both transporters can facilitate zinc uptake, but ZnuACB demonstrates higher efficiency when expressed at wild-type levels .

What methods are available for constructing zupT mutants and reporter strains?

Several methodological approaches are documented for genetic manipulation of zupT:

Construction of chromosomal Φ(zupT-lacZ) transcriptional fusion:

  • Amplify the regions upstream and downstream of the zupT stop codon

  • Join these fragments with restriction enzyme sites (e.g., BamHI, XbaI) inserted at the junction

  • Clone the joined fragment into a suitable vector (e.g., pGEM T-Easy)

  • Insert a promoterless lacZ gene into the restriction sites

  • Subclone the zupT-lacZ fragment into a recombination vector (e.g., pKO3)

  • Perform double recombination to integrate the fusion into the chromosome

  • Verify correct insertion by PCR

Expression of recombinant ZupT:

  • Clone zupT into an expression vector with an inducible promoter

  • Transform into an expression strain (e.g., E. coli BL21)

  • Culture at appropriate temperature (e.g., 30°C) to OD₆₀₀ of 1.0

  • Induce expression (e.g., with anhydrotetracycline at 200 μg/L)

  • Harvest cells after appropriate induction period (e.g., 3 hours)

  • Lyse cells using appropriate method (e.g., French press) with protease inhibitors

  • Purify recombinant protein using appropriate chromatography methods

What experimental approaches can determine ZupT's metal transport kinetics and specificity?

To characterize ZupT's transport properties, researchers employ various complementary approaches:

Radioactive metal uptake assays:

  • Express ZupT in appropriate bacterial background (often a strain lacking other metal transporters)

  • Expose cells to radioactive metal ions (e.g., ⁶⁵Zn²⁺, ⁵⁵Fe²⁺, ⁵⁷Co²⁺)

  • Allow uptake for defined periods at controlled temperature

  • Wash cells to remove external radioactivity

  • Measure accumulated radioactivity using a scintillation counter

  • Calculate uptake rates under various conditions

Competition assays:

  • Perform radioactive metal uptake in the presence of increasing concentrations of non-radioactive competing metals

  • Determine the concentration of competing metal required for 50% inhibition (IC₅₀)

  • Compare IC₅₀ values to establish relative affinities for different metals

Growth complementation studies:

  • Construct strains with deletions in various metal transport systems

  • Express ZupT or mutant variants in these backgrounds

  • Assess growth in metal-limited media, often supplemented with chelators

  • Quantify growth parameters (lag time, doubling time, final density)

  • Compare growth across different metal availabilities and genetic backgrounds

Research demonstrates that E. coli K-12 and uropathogenic E. coli Δznu ΔzupT double mutants show decreased ⁶⁵Zn²⁺ uptake and impaired growth in minimal medium, confirming the importance of both transporters for zinc acquisition .

How does zinc limitation affect ZupT expression and function?

Zinc limitation triggers complex transcriptional responses in E. coli to maintain zinc homeostasis:

  • Under zinc-replete conditions, the zinc uptake regulator (Zur) binds zinc and represses the transcription of high-affinity zinc transport systems like ZnuACB

  • When zinc becomes limiting, Zur releases from its binding sites, allowing expression of these transporters

  • ZupT appears to be regulated differently from ZnuACB, with less direct responsiveness to zinc limitation

To study ZupT regulation under zinc limitation, researchers typically:

  • Construct transcriptional reporter fusions (e.g., zupT-lacZ)

  • Monitor reporter activity across varying zinc concentrations

  • Use defined media with controlled metal content

  • Add zinc chelators (e.g., EDTA, TPEN) to further restrict zinc availability

  • Analyze transcript levels using qRT-PCR or RNA-Seq

  • Perform chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the zupT promoter

The differential regulation of ZupT compared to ZnuACB suggests complementary roles in maintaining zinc homeostasis across varying environmental conditions.

How does ZupT contribute to E. coli survival during infection?

ZupT plays a significant role in E. coli pathogenesis, particularly for uropathogenic strains causing urinary tract infections (UTIs). Experimental evidence demonstrates:

  • In competitive infections in CBA/J mice, UPEC Δznu ΔzupT double mutants showed significantly reduced colonization in both bladders (mean 30-fold reduction) and kidneys (mean 48-fold reduction)

  • Single-strain infection experiments confirmed that Δznu and Δznu ΔzupT mutants were significantly reduced in kidney colonization (p=0.0012 and p<0.0001, respectively)

  • Complementation with the znuACB genes restored growth in zinc-deficient medium and bacterial numbers in bladder and kidneys

  • ΔzupT single mutants showed no significant disadvantage during UTI, suggesting ZnuACB can compensate for ZupT loss

The contribution of ZupT to pathogenesis appears linked to:

  • Reduced motility in zinc-limited conditions, which can be restored by zinc supplementation

  • Decreased resistance to hydrogen peroxide, suggesting impaired response to oxidative stress

  • Potential roles in other physiological processes relevant to infection

These findings highlight the importance of zinc acquisition systems during infection and suggest ZupT provides a secondary, but significant, pathway for zinc uptake in pathogenic E. coli.

What is the relationship between ZupT activity and bacterial stress responses?

ZupT function intersects with various stress response pathways, particularly oxidative stress resistance:

  • Zinc is an essential cofactor for numerous enzymes involved in antioxidant defense, including superoxide dismutase

  • Δznu ΔzupT mutants show decreased resistance to hydrogen peroxide, which can be restored by zinc supplementation

  • Impaired zinc acquisition affects motility, which is crucial for bacteria to navigate host environments and escape immune defenses

Methodological approaches to investigate these relationships include:

  • Exposure to oxidative stress agents (H₂O₂, paraquat, etc.) with survival quantification

  • Measurement of reactive oxygen species (ROS) using fluorescent probes

  • Assessment of antioxidant enzyme activities in wild-type versus mutant strains

  • Motility assays on semi-solid agar

  • Gene expression profiling under combined zinc limitation and stress conditions

The dual impact on both oxidative stress resistance and motility suggests ZupT contributes to multiple aspects of bacterial fitness during infection.

How can ZupT be engineered for biotechnological applications?

ZupT's broad substrate specificity makes it an attractive target for protein engineering aimed at various applications:

Potential engineering approaches:

  • Site-directed mutagenesis of metal-coordinating residues to alter selectivity

  • Directed evolution to enhance transport capacity or substrate specificity

  • Domain swapping with other transporters to create hybrid proteins with novel properties

  • Promoter engineering to optimize expression under specific conditions

Potential applications:

  • Bioremediation of metal-contaminated environments

  • Metal recovery from industrial waste

  • Development of whole-cell biosensors for metal detection

  • Synthetic biology applications requiring controlled metal uptake

  • Enhanced mineral nutrition in engineered microorganisms

Engineering efforts would require rigorous validation using methods such as:

  • Radioactive metal uptake assays

  • Growth complementation studies

  • Protein localization and stability assessment

  • In vitro transport assays with reconstituted proteins

What insights do comparative analyses between prokaryotic ZupT and eukaryotic ZIP transporters provide?

ZupT belongs to the ZIP family of transporters that are more prevalent in eukaryotes, offering an opportunity to understand evolutionary relationships and functional conservation:

  • Heterologous expression studies show that Arabidopsis thaliana ZIP1 can functionally complement iron uptake deficiencies in E. coli strains lacking iron transport systems, similar to ZupT

  • This functional conservation suggests shared transport mechanisms despite evolutionary distance

  • Comparative sequence and structural analyses can identify conserved residues critical for function

  • Studies of metal selectivity across different ZIP family members provide insights into determinants of substrate specificity

Research approaches for comparative analysis include:

  • Phylogenetic analysis to map evolutionary relationships

  • Heterologous expression of ZIP transporters from different organisms in E. coli

  • Complementation studies to assess functional conservation

  • Structural modeling and comparison

  • Site-directed mutagenesis of conserved residues

Such comparative studies enhance our understanding of metal transport mechanisms across domains of life and can inform protein engineering efforts.

What are the optimal conditions for expressing and purifying recombinant ZupT?

Successful expression and purification of functional ZupT requires careful optimization:

Expression conditions:

  • Select an appropriate expression strain (e.g., E. coli BL21)

  • Culture in rich media (e.g., Luria-Bertani broth) initially

  • Use lower induction temperatures (e.g., 30°C rather than 37°C) to enhance proper folding

  • Induce expression at an appropriate cell density (e.g., OD₆₀₀ of 1.0)

  • Use controlled inducer concentration (e.g., 200 μg/L anhydrotetracycline)

  • Allow adequate expression time (e.g., 3 hours post-induction)

Cell disruption and membrane preparation:

  • Harvest cells by centrifugation (e.g., 7,650 × g, 4°C, 15 min)

  • Resuspend in appropriate buffer (e.g., 100 mM Tris-HCl pH 8.0)

  • Include protease inhibitors and DNase I

  • Disrupt cells using appropriate method (e.g., French press at 138 kPa)

  • Remove cell debris by centrifugation (e.g., 23,400 × g)

  • Separate membrane fraction by ultracentrifugation

  • Solubilize membrane proteins with suitable detergents

Purification strategies:

  • Affinity chromatography using engineered tags (His-tag, Strep-tag, etc.)

  • Ion exchange chromatography

  • Size exclusion chromatography for final polishing

  • Maintain appropriate detergent concentrations throughout purification

  • Consider including stabilizing agents (glycerol, specific lipids, etc.)

Verification of functional status post-purification is essential, often using reconstitution into liposomes followed by transport assays.

What methods are most effective for studying the ZupT structure-function relationship?

Understanding the relationship between ZupT structure and function requires a multidisciplinary approach:

Structural characterization:

  • X-ray crystallography of purified protein

  • Cryo-electron microscopy

  • Nuclear magnetic resonance (NMR) for specific domains

  • Computational modeling based on homologous proteins

  • Hydrogen-deuterium exchange mass spectrometry to probe dynamics

Functional analysis:

  • Site-directed mutagenesis of putative metal-binding residues

  • Alanine-scanning mutagenesis of transmembrane domains

  • Construction of chimeric proteins with other transporters

  • Transport assays with radioactive metals

  • Growth complementation studies with mutant variants

  • Accessibility studies using chemical modification

Correlation methods:

  • Molecular dynamics simulations

  • Evolutionary coupling analysis

  • Statistical correlation between sequence conservation and function

  • Structure-guided mutagenesis

These approaches together can elucidate critical residues for metal binding, transport pathway architecture, and conformational changes associated with transport.

How can researchers reconcile conflicting data regarding ZupT substrate specificity?

Researchers investigating ZupT substrate specificity may encounter apparently conflicting results due to:

  • Differences in experimental systems (in vivo vs. in vitro)

  • Variations in expression levels affecting apparent specificities

  • Background strain differences (K-12 vs. pathogenic isolates)

  • Differences in metal availability in growth media

  • Competing transport systems present in some experimental setups

To reconcile conflicting data, consider these methodological approaches:

  • Standardization of experimental conditions:

    • Use defined media with controlled metal concentrations

    • Express ZupT at comparable levels across experiments

    • Use genetic backgrounds lacking other metal transporters

    • Control for metal contamination in reagents

  • Complementary methodologies:

    • Compare direct transport assays (radioactive uptake) with indirect methods (growth complementation)

    • Measure metal accumulation using multiple techniques (radioactivity, ICP-MS)

    • Perform competition assays to establish relative affinities

  • Systematic comparison:

    • Create a standardized experimental framework for comparing results across studies

    • Generate a comprehensive dataset using identical conditions across multiple metal substrates

    • Analyze data using consistent statistical methods

In one comparative study, ZupT was shown to transport both zinc and iron, but with ZnuACB being the predominant zinc transporter and ZupT playing a more significant role when the primary system was absent .

What statistical approaches are most appropriate for analyzing ZupT transport kinetics?

Proper statistical analysis is crucial for accurately characterizing ZupT transport kinetics:

  • Kinetic parameter estimation:

    • Non-linear regression to fit data to appropriate transport models (Michaelis-Menten, Hill equation)

    • Estimation of Km, Vmax, and other relevant parameters

    • Bootstrap or jackknife resampling for robust parameter confidence intervals

  • Comparison between conditions:

    • Analysis of variance (ANOVA) for multiple condition comparisons

    • Post-hoc tests with appropriate corrections for multiple comparisons

    • Mixed-effects models when dealing with repeated measures or nested designs

  • Model selection:

    • Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) to compare competing kinetic models

    • Likelihood ratio tests for nested models

    • Cross-validation approaches for predictive accuracy

  • Visualization techniques:

    • Eadie-Hofstee, Lineweaver-Burk, or Hanes-Woolf plots for diagnostic purposes

    • Residual analysis to detect systematic deviations from models

    • Confidence bands around fitted curves

When analyzing competition data, appropriate models accounting for competitive, non-competitive, or uncompetitive inhibition should be applied to accurately interpret the mechanism of interaction between different metal substrates.

What emerging technologies could advance our understanding of ZupT function?

Several cutting-edge technologies show promise for enhancing ZupT research:

  • Cryo-electron microscopy:

    • Allows visualization of membrane proteins in near-native states

    • Can capture different conformational states during transport cycle

    • Requires less protein than crystallography and avoids crystallization artifacts

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • Single-molecule transport assays to detect individual transport events

    • Atomic force microscopy to measure protein-substrate interactions

  • Advanced genetic tools:

    • CRISPR-Cas9 for precise genome editing

    • Multiplexed CRISPRi for simultaneous repression of multiple transporters

    • Deep mutational scanning to comprehensively map structure-function relationships

  • Cellular imaging approaches:

    • Super-resolution microscopy to visualize ZupT localization and dynamics

    • Metal-specific fluorescent probes with subcellular resolution

    • Correlative light and electron microscopy for structure-function studies

  • Computational approaches:

    • Machine learning for predicting substrate specificity

    • Molecular dynamics simulations with enhanced sampling

    • Quantum mechanics/molecular mechanics (QM/MM) calculations for metal coordination

What unresolved questions about ZupT warrant further investigation?

Despite significant advances, several important questions about ZupT remain unanswered:

  • Structural determinants of function:

    • What is the high-resolution structure of ZupT?

    • Which residues coordinate different metal ions?

    • What conformational changes occur during transport?

  • Regulatory mechanisms:

    • How is ZupT expression regulated in response to different metals?

    • What transcription factors control ZupT expression?

    • Are there post-translational modifications affecting ZupT activity?

  • Physiological roles:

    • What is the relative contribution of ZupT to metal homeostasis under different environmental conditions?

    • How does ZupT function integrate with other metal homeostasis systems?

    • Are there additional substrates beyond those currently known?

  • Evolutionary aspects:

    • How did ZupT evolve in bacteria relative to eukaryotic ZIP transporters?

    • Why do some bacteria maintain multiple zinc transport systems?

    • What selective pressures drive ZupT sequence conservation?

  • Potential as a therapeutic target:

    • Could inhibition of ZupT serve as an antibacterial strategy?

    • How does ZupT contribute to bacterial survival during antibiotic treatment?

    • Can ZupT function be modulated to increase bacterial susceptibility to host defenses?

Addressing these questions will require interdisciplinary approaches combining structural biology, genetics, biochemistry, and computational methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.