Recombinant Escherichia coli O9:H4 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O9:H4 4-Hydroxybenzoate Octaprenyltransferase (UbiA)

Recombinant Escherichia coli O9:H4 4-hydroxybenzoate octaprenyltransferase (UbiA) is a key enzyme in the ubiquinone (Coenzyme Q) biosynthesis pathway. It catalyzes the condensation of 4-hydroxybenzoate (4HB) with an octaprenyl diphosphate to form 3-octaprenyl-4-hydroxybenzoate, a critical intermediate in ubiquinone-8 production . This membrane-bound prenyltransferase belongs to the UbiA superfamily of intramembrane enzymes, which are essential for synthesizing lipophilic compounds involved in electron transport and antioxidant functions .

Protein Architecture

  • Gene: ubiA (UniProt IDs: Q1R3P6, C5A133, P0AGK3) .

  • Molecular Weight: ~32 kDa .

  • Domains: Contains conserved aspartate-rich motifs (NDXXDXXXD and DXXXD) critical for Mg²⁺ coordination and catalysis .

  • Topology: Predicted to have 8–9 transmembrane helices, with active sites embedded in the membrane .

Catalytic Mechanism

UbiA transfers a 40-carbon octaprenyl chain from farnesylfarnesylgeraniol diphosphate to 4HB via a Mg²⁺-dependent reaction . Structural studies of homologs (e.g., Archaeoglobus fulgidus UbiA) reveal a conserved active site that accommodates aromatic substrates and isoprenoid diphosphates .

Expression Systems

Recombinant UbiA is produced in E. coli with an N-terminal His tag for affinity chromatography . Key specifications include:

ParameterDetails
HostE. coli
TagN-terminal His tag
Purity>85–90% (SDS-PAGE)
FormLyophilized powder or liquid in Tris/PBS buffer with 6% trehalose
Storage–20°C/–80°C; avoid freeze-thaw cycles

Sequence Information

The full-length protein (290 amino acids) includes conserved residues for substrate binding (e.g., Asp-70, Asp-74) and a catalytic Mg²⁺ site .

Role in Ubiquinone Biosynthesis

  • UbiA-deficient E. coli strains exhibit respiratory defects due to impaired ubiquinone-8 synthesis .

  • Complementation with yeast COQ2 (a homolog) restores ubiquinone production, confirming functional conservation .

Regulatory Insights

  • Catabolite Repression: ubiA expression is downregulated by glucose via the ArcA transcription factor .

  • Anaerobic Biosynthesis: UbiA collaborates with UbiT, UbiU, and UbiV under low oxygen to enable O₂-independent hydroxylation .

Industrial Biotechnology

  • Engineered UbiA variants are explored for enhanced CoQ10 production in microbial systems .

  • Protein engineering of conserved motifs (e.g., Asp-rich regions) improves catalytic efficiency .

Disease Relevance

  • Mutations in human UBIAD1 (a UbiA homolog) link to Schnyder corneal dystrophy and Parkinson’s disease .

Comparative Analysis of UbiA Products

ParameterCreative Biomart MyBioSource
Catalog No.RFL30879EF, RFL7455EF, RFL8276EFMBS1143029
Purity>90%>85%
Storage BufferTris/PBS, 6% trehaloseVariable (lyophilized/liquid)
ApplicationsEnzyme assays, structural studiesELISA, WB, functional assays

Key Research Findings

  1. Structural Insights: Crystal structures of UbiA homologs reveal pseudosymmetric four-helix bundles and substrate-binding pockets critical for prenyl chain positioning .

  2. Evolutionary Conservation: UbiA shares mechanistic features with archaeal and eukaryotic prenyltransferases, including Mg²⁺-dependent catalysis .

  3. Physiological Impact: UbiA is essential for E. coli survival under aerobic and anaerobic conditions, linking ubiquinone to nitrate respiration and uracil biosynthesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ubiA; EcHS_A4280; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSIVVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis, which involves the condensation of the polyisoprenoid side chain with PHB, resulting in the formation of the first membrane-bound Q intermediate, 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ubiA in E. coli?

The ubiA gene in Escherichia coli encodes 4-hydroxybenzoate octaprenyl transferase, which is a key enzyme in the ubiquinone biosynthesis pathway. This membrane-bound transferase catalyzes the attachment of octaprenyl diphosphate to 4-hydroxybenzoate, representing a critical step in ubiquinone production. This reaction occurs after 4-hydroxybenzoate formation and serves as the foundation for subsequent enzymatic modifications in the pathway . The enzyme is essential for aerobic respiration, as ubiquinone acts as an electron and proton shuttle in the respiratory chain of E. coli under aerobic conditions .

What is the molecular weight of the ubiA protein?

The molecular mass of the ubiA protein product has been determined to be 32 kD (kilodaltons) through overexpression studies of the ubiA gene in E. coli . This finding helps researchers in verifying proper protein expression and purification through techniques such as SDS-PAGE and western blotting. When designing recombinant expression systems, this molecular weight information is critical for optimizing purification protocols and confirming the identity of the expressed protein.

How is the ubiA gene expression regulated in E. coli?

Studies using ubiA-lacZ fusion systems have demonstrated that ubiA expression is catabolite-repressed by glucose . This means that in the presence of glucose, the expression of the ubiA gene is reduced. Additionally, this glucose-mediated repression becomes more pronounced in arcA mutant strains . ArcA functions as a transcriptional regulator for oxygen-regulated genes, suggesting that ubiA expression is influenced by both carbon source availability and oxygen sensing mechanisms. This dual regulation reflects the enzyme's role in aerobic respiration and energy metabolism.

What occurs when the ubiA gene is disrupted in E. coli?

When the ubiA gene is disrupted in E. coli through chromosomal gene replacement techniques (such as insertion of a chloramphenicol resistance gene), the resulting mutant strains exhibit a respiration-defective phenotype . This defect is characterized by impaired aerobic growth and diminished respiratory chain activity due to the inability to synthesize ubiquinone. The phenotype demonstrates the essential nature of ubiA in maintaining proper respiratory function under aerobic conditions in E. coli.

How does the specificity of E. coli ubiA compare to homologous enzymes in other organisms?

E. coli ubiA shows functional homology with the COQ2 gene product from Saccharomyces cerevisiae, which encodes 4-hydroxybenzoate hexaprenyl transferase . Expression of the yeast COQ2 gene can functionally complement E. coli ubiA mutants, restoring ubiquinone-8 production and respiratory competence . This cross-species complementation indicates that COQ2 can catalyze the same enzymatic reaction as ubiA despite differences in prenyl chain length preference (hexaprenyl vs. octaprenyl). This suggests a broad substrate specificity for COQ2 regarding the prenyl donor, an important consideration when studying the enzyme's structure-function relationships and evolutionary conservation.

What is the relationship between ubiA and the anaerobic UbiUVT complex?

While ubiA functions primarily in the aerobic ubiquinone biosynthesis pathway, E. coli also possesses an O2-independent ubiquinone biosynthesis pathway mediated by the UbiUVT complex . This anaerobic pathway operates under oxygen-limited conditions and is regulated by the O2-sensing Fnr transcriptional regulator . The UbiUVT complex contributes to ubiquinone hydroxylation through a unique O2-independent process, representing a parallel pathway to the classical aerobic route involving ubiA. Analysis of deletion mutants reveals that UbiUV-dependent UQ synthesis is essential for nitrate respiration and uracil biosynthesis under anaerobiosis, while ubiA-dependent synthesis dominates under aerobic conditions .

How do oxygen levels affect ubiquinone biosynthesis pathways in E. coli?

E. coli employs different isoprenoid quinones depending on oxygen availability: ubiquinone (UQ) predominates under aerobic conditions, while demethylmenaquinones (DMK) are mainly used under anaerobic conditions . Recent research has established the existence of an anaerobic O2-independent UQ biosynthesis pathway controlled by ubiT, ubiU, and ubiV genes . The two pathways (aerobic and anaerobic) allow E. coli to adjust its metabolism in response to changing oxygen levels and respiratory conditions. UbiT plays a crucial role in facilitating efficient transition from anaerobic to aerobic conditions, as demonstrated by the significantly longer lag period observed in ΔmenA ΔubiT mutants compared to ΔmenA ΔubiUV and wild-type strains when shifted from anaerobic to aerobic growth .

What is the role of UbiT in the transition between anaerobic and aerobic metabolism?

UbiT serves as an accessory factor that plays a crucial role during the transition from anaerobic to aerobic conditions. Deletion of ubiT results in dramatically extended lag phases when cultures are shifted from anaerobic to aerobic conditions. Specifically, a ΔmenA ΔubiT strain exhibits a lag period 3-5 times longer than those observed in ΔmenA ΔubiUV and wild-type strains during such transitions . Direct quantification of ubiquinone synthesis after shifting from anaerobiosis to aerobiosis reveals a 2-fold reduction in UQ in the ΔubiT mutant compared to the ΔubiUV mutant . These findings suggest that UbiT is particularly necessary at the onset of aerobic UQ biosynthesis, potentially working with the UbiIHF complex to facilitate rapid adaptation to changing oxygen availability.

What genetic techniques can be used to study ubiA function?

Several genetic approaches are effective for studying ubiA function:

  • Gene disruption: Chromosomal gene replacement with selectable markers (e.g., chloramphenicol resistance gene) can create ubiA knockout strains .

  • Complementation assays: Expressing ubiA or homologous genes (like COQ2) in ubiA mutants to test functional rescue .

  • Gene fusion systems: ubiA-lacZ fusions can be used to study gene expression regulation .

  • P1 transduction: For transferring mutations between strains, as demonstrated with the UbiUVT system .

  • Site-directed mutagenesis: For studying specific amino acid residues important for enzyme function.

These techniques allow researchers to assess the phenotypic consequences of ubiA disruption and to study the regulatory mechanisms controlling ubiA expression in various genetic backgrounds and environmental conditions.

How can researchers construct and verify ubiA mutant strains?

Construction and verification of ubiA mutant strains can be accomplished through the following methods:

MethodApplicationVerificationReference
PCR recombination with Lambda-Red systemTargeted gene knockoutAntibiotic sensitivity and PCR amplification
P1 transductionTransfer mutations between strainsPCR confirmation
pKO3 vector systemIntroduction of point mutationsSequencing
FLP recombinase (pCP20 plasmid)Removal of antibiotic markersAntibiotic sensitivity testing

After constructing mutant strains, phenotypic verification can include testing for growth defects under aerobic conditions, measuring ubiquinone levels using chromatography techniques, and assessing respiratory chain activity through oxygen consumption measurements or growth on different carbon sources.

What experimental systems are suitable for studying the transition between anaerobic and aerobic metabolism?

To study the transition between anaerobic and aerobic metabolism, researchers can employ the following experimental design:

  • Initial growth: Cultivate strains (wild-type, ΔmenA, ΔubiUV, ΔubiT mutants) in LB medium supplemented with nitrate under anaerobic conditions .

  • Medium shift: Transfer cultures to minimal medium with succinate as a carbon source under aerobic conditions .

  • Growth monitoring: Record optical density (OD600) measurements at regular intervals to track adaptation to aerobiosis .

  • Quinone quantification: Extract and measure ubiquinone levels at different time points using analytical techniques like HPLC .

  • Re-inoculation experiments: Test the ability of adapted cultures to resume growth upon fresh inoculation .

This experimental system can reveal differences in adaptation efficiency between strains and the specific roles of different components of the ubiquinone biosynthesis pathways during metabolic transitions.

What control strains should be included when studying ubiA function?

When designing experiments to investigate ubiA function, the following control strains should be included:

  • Wild-type E. coli: As a positive control demonstrating normal ubiquinone biosynthesis and respiratory function.

  • ubiA knockout strain: To confirm the phenotype associated with complete loss of ubiA function.

  • Complemented ubiA strain: ubiA mutant expressing a functional copy of ubiA to verify that observed phenotypes are specifically due to ubiA disruption.

  • menA knockout strain: As a control lacking demethylmenaquinone synthesis, useful for isolating the effects of ubiquinone-dependent processes .

  • ubiUV knockout strain: To differentiate between aerobic and anaerobic ubiquinone biosynthesis pathways .

For studies on regulatory mechanisms, additional controls might include arcA mutants (to study oxygen-dependent regulation) or fnr mutants (to examine anaerobic regulation pathways) .

What factors affect ubiA expression and activity in experimental settings?

Several factors can influence ubiA expression and activity in experimental settings:

Researchers should carefully control these variables when designing experiments to ensure reproducibility and accurate interpretation of results related to ubiA function.

How can researchers differentiate between the roles of ubiA and UbiUVT in ubiquinone biosynthesis?

To distinguish between the contributions of ubiA (aerobic pathway) and UbiUVT (anaerobic pathway) to ubiquinone biosynthesis, researchers can employ the following strategies:

  • Genetic approach: Create single and double knockout strains (ΔubiA, ΔubiUV, ΔubiT, ΔubiA ΔubiUV) to isolate the effects of each pathway .

  • Oxygen-controlled experiments: Compare ubiquinone production under strictly aerobic, strictly anaerobic, and transitional conditions .

  • 18O2 labeling experiments: Track the incorporation of oxygen from molecular oxygen (aerobic pathway) versus oxygen from other sources (anaerobic pathway) .

  • Functional assays: Assess specific ubiquinone-dependent functions like nitrate respiration or uracil biosynthesis under anaerobic conditions in different mutant backgrounds .

  • Time-course studies: Monitor ubiquinone synthesis during transitions between anaerobic and aerobic conditions to identify which pathway contributes at different stages .

These approaches can reveal the distinct contributions of each pathway and their coordination in maintaining ubiquinone levels under varying environmental conditions.

How should researchers interpret changes in ubiquinone levels in relation to ubiA activity?

When analyzing ubiquinone levels in relation to ubiA activity, researchers should consider:

  • Background strain effects: Compare data only between isogenic strains differing solely in the gene(s) of interest.

  • Growth conditions: Normalize data to account for differences in growth rates or cell densities between strains or conditions.

  • Multiple extraction methods: Consider using complementary extraction and detection methods to ensure comprehensive ubiquinone profile analysis.

  • Temporal dynamics: Interpret single time-point measurements cautiously, as ubiquinone levels can change dynamically, especially during metabolic transitions .

  • Pathway redundancy: Consider contributions from both aerobic (ubiA-dependent) and anaerobic (UbiUVT-dependent) pathways when interpreting ubiquinone levels .

Decreased ubiquinone levels in ubiA mutants under aerobic conditions strongly suggest impaired ubiA activity, whereas normal levels under anaerobic conditions may indicate compensation through the UbiUVT pathway.

What are common pitfalls in analyzing ubiA expression and function?

Researchers studying ubiA expression and function should be aware of several common pitfalls:

  • Overlooking regulatory effects: Failure to consider how media composition (particularly glucose) affects ubiA expression through catabolite repression .

  • Ignoring oxygen regulation: Not controlling oxygen availability carefully, leading to mixed aerobic/anaerobic conditions and confounded results .

  • Pathway compensation: Neglecting the ability of alternative pathways (like UbiUVT) to compensate for ubiA disruption under certain conditions .

  • Strain background effects: Using strains with undocumented mutations that might affect ubiquinone metabolism.

  • Improper controls: Failing to include appropriate positive and negative controls, especially when studying complementation by homologous genes .

  • Extraction efficiency: Variations in ubiquinone extraction efficiency can lead to misleading quantitative comparisons.

Careful experimental design, appropriate controls, and consideration of these factors can help avoid misinterpretation of results related to ubiA function.

What are promising research avenues for understanding ubiA structure-function relationships?

Future research on ubiA structure-function relationships could focus on:

  • Crystallographic studies: Determining the three-dimensional structure of ubiA to understand substrate binding and catalytic mechanisms.

  • Comparative analysis: Further investigation of functional homologs like COQ2 from yeast to identify conserved catalytic domains and species-specific features .

  • Mutagenesis studies: Systematic site-directed mutagenesis to identify key residues involved in substrate binding, catalysis, and membrane association.

  • Protein-protein interactions: Investigating whether ubiA interacts with other enzymes in the ubiquinone biosynthesis pathway to form functional complexes.

  • Substrate specificity: Exploring the structural basis for the different prenyl donor preferences between homologous enzymes from different species .

These approaches could provide valuable insights into the catalytic mechanism of ubiA and guide the development of specific inhibitors or engineered variants with enhanced activity.

How might ubiA research contribute to understanding bacterial adaptation to environmental changes?

Research on ubiA and related enzymes can enhance our understanding of bacterial adaptation mechanisms:

  • Metabolic flexibility: Studies on the interplay between ubiA and UbiUVT pathways reveal how bacteria maintain essential functions under fluctuating oxygen conditions .

  • Host colonization: Understanding how ubiquinone biosynthesis contributes to bacterial multiplication in host environments, such as the mouse gut .

  • Pathogen survival: Insights from E. coli studies may apply to facultative anaerobic pathogens like Salmonella, Shigella, and Vibrio, helping to unravel infection dynamics .

  • Microbiota interactions: Research on quinone biosynthesis pathways could help explain competition and cooperation within microbial communities .

  • Stress responses: Investigating how ubiA regulation integrates with broader cellular stress response networks.

This research has implications beyond fundamental biochemistry, potentially informing strategies for modulating bacterial behavior in medical, environmental, and industrial contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.