Recombinant Escherichia coli O9:H4 ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
atpF; EcHS_A3952; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core; and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, linking the F1 and F0 domains.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How do mutations in the b subunit affect ATP synthase assembly and function, and what methodologies are best for assessing these effects?

Mutations in the b subunit can profoundly affect ATP synthase assembly and function, with effects varying based on the specific domain affected:

Dimerization Domain Mutations: Deletions or substitutions in residues 60-122 can disrupt the coiled-coil structure required for proper b-b interactions. For example, mutations that disrupt the leucine zipper-like motif in this region prevent proper dimerization, resulting in assembly defects . Research has shown that even partial deletions in this domain can prevent proper enzyme assembly.

Delta-Binding Domain Mutations: The last four C-terminal amino acids have been shown to be critical for enzyme assembly through interactions with the δ subunit. Truncation of these residues results in assembly-defective complexes .

Membrane Domain Mutations: Alterations in the N-terminal transmembrane segment affect membrane anchoring and can destabilize the entire F₀ complex.

Tether Domain Mutations: An evolutionarily conserved arginine, b(Arg-36), is crucial for F₁F₀ ATP synthase function. Mutation of this residue disrupts proper coupling between F₀ and F₁ .

Methodological Approaches for Assessment:

  • ATP Synthesis/Hydrolysis Assays: Measuring ATP synthesis rates in membrane vesicles or reconstituted proteoliposomes containing mutant complexes provides direct functional assessment.

  • Proton Pumping Assays: Using pH-sensitive fluorescent dyes to measure proton translocation across membranes containing mutant ATP synthases.

  • Genetic Complementation: Co-expressing two different mutant b subunits to determine if they can functionally complement each other. This approach revealed that heterodimeric F₁F₀ complexes with one wild-type and one mutant b subunit can be functional, indicating differential roles for each b subunit .

  • Blue Native PAGE: For assessing the assembly state of the ATP synthase complex with mutant b subunits.

  • Thermal Stability Assays: To determine if mutations affect the stability of the b subunit or the entire complex.

  • What is the role of the b subunit dimer in addressing the symmetry mismatch between F₀ and F₁ sectors during rotational catalysis?

The ATP synthase complex presents an intriguing structural puzzle: while the F₁ sector exhibits 3-fold pseudo-symmetry across all species, the F₀ sector shows diverse symmetries ranging from 7- to 13-fold . This creates a fundamental challenge for energy transduction, as the rotation units in F₀ and F₁ are inconsistent.

The b subunit dimer plays a crucial role in accommodating this symmetry mismatch through several mechanisms:

Elastic Coupling Function: The peripheral stalk formed by the b subunit dimer functions as an elastic element that can store and release torsional energy during rotational catalysis . This elasticity helps smooth the transition between the discrete steps of the F₀ rotor and the three catalytic sites of F₁.

Experimental evidence supports this model:

  • The long α-helical structure of the b dimer provides structural flexibility

  • Single-molecule studies have measured transient elastic energy storage in the peripheral stalk

  • Mutations that alter the rigidity of the b subunit dimer affect coupling efficiency

Rotational Strain Absorption: Recent cryo-EM studies have revealed that the peripheral stalk may redistribute differences in torsional energy across three unequal steps in the rotation cycle . The peripheral stalk appears to act like an elastic spring, evening out the different energy contributions of each step.

Methodological Approaches:
To investigate this role, researchers have employed:

  • Single-molecule rotational studies using attached fluorescent probes or beads

  • Molecular dynamics simulations to calculate torsional strain energies

  • Cross-linking studies at different positions to restrict flexibility

  • Optical tweezers experiments to measure force generation

The current model suggests that during ATP synthesis, the proton-driven rotation of the c-ring in F₀ is transmitted through the central stalk to F₁, with the b subunit dimer providing the necessary counter-torque while accommodating the symmetry mismatch through its elastic properties .

  • How does the interaction between ATP synthase subunit b and the O-antigen structure in E. coli O9:H4 affect membrane integration and function?

The interaction between ATP synthase subunit b and the O-antigen structure in E. coli O9:H4 represents an interesting aspect of membrane protein integration in different bacterial serotypes:

O-Antigen Structure in E. coli O9:H4:
E. coli O9 has a distinctive O-antigen structure consisting of mannose polymers . The O9 antigen gene cluster is located between the conserved housekeeping genes galF and gnd . Unlike many other serotypes, the O9 O-units lack N-acetylglucosamine (GlcNAc) and N-acetylgalactosamine (GalNAc) .

Membrane Integration Considerations:
The transmembrane domain of ATP synthase subunit b must properly integrate into membranes containing this particular O-antigen structure. Research approaches to study this interaction include:

  • Membrane Fluidity Analysis: Fluorescence anisotropy measurements comparing membrane fluidity in strains with different O-antigens

  • Lipid-Protein Interaction Studies: Mass spectrometry-based analyses of lipids associated with purified ATP synthase from different E. coli serotypes

  • Functional Reconstitution: Activity measurements of ATP synthase reconstituted into liposomes with varying lipid compositions mimicking different serotype membranes

Serotype-Specific Considerations:
E. coli O9:H4 and O104:H4 strains show interesting antigenic relationships. Absorption studies with anti-O104 and anti-O9 antibodies have demonstrated cross-reactivity, suggesting structural similarities between these serotypes . This relationship may affect how membrane proteins like ATP synthase integrate and function in these different backgrounds.

Interestingly, an antigenic cross-reaction between these serotypes has been demonstrated through microagglutination tests. The anti-E. coli O9 serum reacts with O9 antigen at dilutions of 1:1600 and with O104 antigen at dilutions of 1:400, indicating partial structural similarity . This relationship may influence the membrane environment in which the ATP synthase b subunit must function.

  • What are the current hypotheses regarding the asymmetric function of the b subunit dimer, and how can these be experimentally tested?

Despite being a homodimer of identical proteins, the b subunit dimer appears to perform asymmetric functions in ATP synthase, raising intriguing questions about functional specialization:

Current Hypotheses:

  • Differential Interaction Model: Each b subunit makes unique contacts with other ATP synthase components. One b subunit may primarily interact with the a subunit in F₀, while the other interacts more extensively with the δ subunit in F₁ .

  • Conformational Asymmetry Model: Despite identical sequences, the two b subunits adopt different conformations when assembled into the ATP synthase complex, potentially allowing for different functional roles .

  • Dynamic Exchange Model: The two b subunits may exchange roles during the catalytic cycle, with their functions alternating in response to rotational changes in the complex.

Experimental Evidence:
The most compelling evidence comes from genetic complementation studies showing that two different b subunit mutants, each individually inactivating when present as homodimers, can form functional heterodimers . This mutual complementation indicates that each b subunit makes a unique contribution to peripheral stalk function.

Methodological Approaches for Testing These Hypotheses:

  • Asymmetric Crosslinking Studies: Using heterobifunctional crosslinkers with different functional groups on each end to identify differential interactions of each b subunit with other components.

  • Fusion Protein Approach: Creating b/δ fusion proteins to restrict the interaction of one b subunit, forcing the other to adopt a specific role. Studies with such constructs have provided insights into the individual functions of each b subunit .

  • Single-Molecule FRET: Labeling each b subunit with different fluorophores to detect conformational differences and changes during the catalytic cycle.

  • Hydrogen-Deuterium Exchange Mass Spectrometry: This technique can identify differences in solvent accessibility between the two b subunits when assembled in the complex, revealing structural asymmetry.

  • Site-Directed Spin Labeling: Using electron paramagnetic resonance (EPR) to measure distances between specific residues in each b subunit and other components of the complex.

The elucidation of this functional asymmetry will provide critical insights into the mechanism of energy conversion in ATP synthase and may guide the development of selective inhibitors targeting specific functions of the b subunit.

Data Table: E. coli ATP Synthase b Subunit Domain Structure and Function

DomainResiduesStructureFunctionKey Experimental Methods
Membrane1-24Single transmembrane α-helixAnchors b subunit in membrane; interacts with a subunitSite-directed mutagenesis; deletion analysis
Tether25-59Extended α-helixConnects membrane domain to dimerization domain; contains critical b(Arg-36)Genetic complementation; arginine substitution
Dimerization60-122Coiled-coil structureForms parallel dimer; provides elasticity for energy storageDeletion analysis; circular dichroism; crosslinking
δ-binding123-156More globular structureInteracts with F₁ via δ subunit; critical for F₁-F₀ couplingC-terminal truncation; protein-protein interaction studies

Research Applications and Future Directions

  • How can structural information about recombinant E. coli O9:H4 ATP synthase subunit b be applied to develop antimicrobial strategies?

ATP synthase represents a promising antimicrobial target due to its essential role in bacterial energy metabolism. The b subunit, with its unique structural features and critical role in enzyme assembly and function, offers several potential avenues for antimicrobial development:

Target-Specific Considerations:

The b subunit contains several structurally and functionally distinct elements that could be targeted:

Methodological Approaches:

To develop such inhibitors, researchers can employ:

  • Structure-Based Drug Design: Using the high-resolution structures of the b subunit and its interfaces with other components to design small molecules that specifically disrupt these interactions.

  • Peptide Mimetics: Developing peptides that mimic critical interaction regions of the b subunit but contain modifications that enhance binding affinity or stability.

  • High-Throughput Screening: Screening chemical libraries against purified b subunit or reconstituted ATP synthase to identify compounds that specifically disrupt b subunit function.

  • In silico Docking Studies: Computational prediction of small molecules that might bind to critical regions of the b subunit, followed by experimental validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.