Recombinant Escherichia coli O9:H4 Bifunctional protein aas (aas)

What is the structural composition of Bifunctional protein aas?

Bifunctional protein aas (aas) from Escherichia coli O9:H4 is a full-length protein consisting of 719 amino acids with a molecular structure that supports its dual functionality. The complete amino acid sequence begins with MLFSFFRNLCRVLYRVRVTGDTQALKGERVLITPNHVSFIDGILLGLFLPVRPVFAVYTS and continues through to its C-terminal end . The protein contains two distinct functional domains: a 2-acylglycerophosphoethanolamine acyltransferase domain (EC= 2.3.1.40) and a second catalytic region . This bifunctionality enables the protein to participate in multiple metabolic pathways within the bacterial cell. The tertiary structure features catalytic sites specific to each function, allowing for independent activity regulation. Researchers should note that the native protein can be recombinantly produced with an N-terminal His-tag for purification purposes without significantly altering its functional properties .

What are the optimal storage conditions for maintaining protein activity?

Maintaining optimal activity of recombinant Bifunctional protein aas requires specific storage conditions to prevent degradation and preserve functionality. The protein should be stored at -20°C/-80°C upon receipt, with aliquoting being necessary for multiple use scenarios to avoid repeated freeze-thaw cycles . For short-term work, working aliquots can be stored at 4°C for up to one week . The recommended storage buffer consists of a Tris/PBS-based solution containing 6% Trehalose at pH 8.0 , although some preparations may utilize a Tris-based buffer with 50% glycerol optimized specifically for this protein . This high glycerol concentration provides cryoprotection and maintains protein solubility. Researchers should be particularly vigilant about preventing repeated freeze-thaw cycles, which can significantly reduce enzymatic activity through protein denaturation and aggregation. Temperature fluctuations should be minimized during storage, and proper labeling of stored aliquots with preparation dates is essential for tracking potential activity loss over time.

What reconstitution protocols yield optimal protein activity?

The reconstitution of lyophilized Bifunctional protein aas requires a methodical approach to maximize protein recovery and activity. Prior to opening the vial, it should be briefly centrifuged to ensure all material settles at the bottom, preventing loss of product . The recommended protocol involves reconstitution in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . Following initial resuspension, the addition of glycerol to a final concentration of 5-50% is recommended, with 50% being the standard laboratory practice for this protein . This glycerol addition serves multiple purposes: it prevents protein aggregation, provides cryoprotection, and maintains enzymatic activity during freeze-thaw cycles. For experimental applications requiring lower glycerol concentrations, researchers should first reconstitute at high concentration, then dilute in the appropriate experimental buffer immediately before use. It is advisable to test multiple reconstitution conditions when working with a new batch of protein to determine optimal activity parameters for specific experimental endpoints.

How can metabolic labeling techniques be optimized for studying Bifunctional protein aas interactions?

Metabolic labeling provides a powerful approach for visualizing and tracking Bifunctional protein aas activity within cellular systems. Based on techniques developed for similar bacterial proteins, researchers can implement a targeted strategy using unnatural GlcNAc analogs such as GlcNAz . The optimization process should begin with bacterial culture growth to mid-log phase (OD600 approximately 0.45), followed by the addition of the azide-containing sugar analog at concentrations ranging from 100-500 μg/ml . The effectiveness of labeling can be concentration-dependent, with higher concentrations potentially yielding stronger signals but also potentially causing metabolic stress. Researchers should establish a titration curve to determine the optimal concentration for their specific experimental system.

For visualization, click chemistry approaches utilizing DBCO-Cy5 or FAM alkyne provide robust detection methods . The specificity of labeling can be verified through control experiments substituting non-azide monosaccharides. Flow cytometry analysis provides quantitative assessment of labeling efficiency, while fluorescence microscopy enables spatial localization studies. For dual-labeling experiments, researchers should consider the ratio between azide monosaccharides and non-azide monosaccharides, with tested ratios ranging from 1:1 to 1:8 (0.45M:0.45M to 0.1M:0.8M) . This approach allows for the fine-tuning of label incorporation while maintaining physiological protein function.

What CRISPR-Cas9 strategies are effective for studying Bifunctional protein aas function?

CRISPR-Cas9 gene editing offers precise approaches for investigating Bifunctional protein aas functionality through targeted genetic modifications. An effective strategy involves constructing knockout or modified strains using homology-directed repair with appropriate flanking sequences. As demonstrated with similar E. coli strains, researchers can design a system targeting the aas gene locus using plasmids like pKD46 that express the λ Red recombinase system . The process begins with the generation of a PCR fragment containing a kanamycin-resistance cassette flanked by homologous sequences to the target region. Following electrotransformation into competent cells expressing Cas9 and the guide RNA, selection on kanamycin-containing media identifies successful recombinants.

For more sophisticated functional studies, researchers can design knock-in strategies to introduce point mutations or domain modifications that selectively alter one function while preserving the other. This approach requires careful guide RNA design to minimize off-target effects and maximize editing efficiency. Temperature-sensitive plasmids like pCP20 carrying FLP recombinase can subsequently remove the selection marker, leaving a scarless modification . Verification of successful editing should employ both genotypic (sequencing) and phenotypic (functional assays) confirmation. This CRISPR-based approach enables the creation of precisely engineered bacterial strains for dissecting the dual functionality of the aas protein and its involvement in various metabolic pathways.

What analytical approaches best characterize protein-substrate interactions for Bifunctional protein aas?

Characterizing the protein-substrate interactions of Bifunctional protein aas requires multiple complementary analytical approaches. Surface plasmon resonance (SPR) provides real-time, label-free detection of binding kinetics between the purified His-tagged protein and potential substrates. The recombinant protein should be immobilized on an NTA sensor chip via its His-tag, allowing substrates to flow across the surface in a concentration gradient to determine association and dissociation rates . For structural insights, X-ray crystallography of the protein-substrate complex can reveal binding pocket architecture, though this requires highly purified protein (>90% purity as determined by SDS-PAGE) .

Isothermal titration calorimetry (ITC) offers thermodynamic characterization of binding events by measuring heat changes during substrate association. This technique is particularly valuable for distinguishing between the binding properties of the two functional domains. For higher throughput screening, thermal shift assays can identify potential substrates by measuring changes in protein melting temperature upon ligand binding. Nuclear magnetic resonance (NMR) spectroscopy provides atomic-level details of protein-substrate interactions, though this typically requires isotopically labeled protein samples. In cellular contexts, proximity-based labeling methods such as BioID or APEX can identify protein interaction partners in vivo. These multiple approaches should be used in concert to build a comprehensive model of how this bifunctional protein engages with its diverse substrates across different cellular conditions.

What expression systems yield optimal quantities of functional protein?

Optimizing expression of recombinant Bifunctional protein aas requires careful selection of host systems and expression conditions. The standard approach utilizes E. coli expression systems, which provide good protein yields while maintaining native folding of this bacterial protein . When expressing the full-length protein (amino acids 1-719), fusion with an N-terminal His-tag facilitates purification without significant impact on protein function . Expression vectors containing inducible promoters allow for controlled protein production once cultures reach appropriate density, minimizing potential toxicity effects.

For complex functional studies, researchers should consider expression strain selection carefully. BL21(DE3) derivatives may be suitable for basic expression, while strains like Rosetta or Origami can address potential codon usage or disulfide bond formation challenges. Growth temperature modulation (typically lowering to 18-25°C post-induction) can enhance proper folding. Media composition also impacts yield, with enriched media like TB (Terrific Broth) often producing higher protein quantities than standard LB. Post-expression processing should include purification under native conditions using nickel affinity chromatography, followed by additional purification steps such as ion exchange or size exclusion chromatography to achieve >90% purity . Functional validation through activity assays should accompany each purification batch to ensure the protein maintains its dual catalytic capabilities.

What are effective approaches for monitoring domain-specific activities?

Monitoring the distinct catalytic activities of the Bifunctional protein aas requires domain-specific assays that can differentiate between its two functional capabilities. For the 2-acylglycerophosphoethanolamine acyltransferase (EC 2.3.1.40) activity, researchers can employ a spectrophotometric assay that follows the transfer of acyl groups between substrates . This typically involves monitoring the release of free CoA through coupling with 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB), which produces a measurable absorbance change at 412 nm. The assay should be conducted in a buffer system optimized to pH 8.0, similar to the protein's storage conditions .

For simultaneous assessment of both catalytic functions, researchers can develop a dual-reporter system using differentially labeled substrates specific to each domain. Fluorescence resonance energy transfer (FRET)-based approaches allow real-time monitoring of activity, with substrate conversion causing measurable changes in the FRET signal. Alternatively, mass spectrometry can provide detailed analysis of reaction products from both catalytic domains simultaneously. Site-directed mutagenesis of key catalytic residues in each domain individually can create control proteins with selective inactivation of one function while preserving the other. These mutant proteins serve as valuable controls for validating the specificity of activity assays and for determining potential interdependence between the two catalytic functions.

How can researchers address protein aggregation challenges?

Protein aggregation presents a significant challenge when working with Bifunctional protein aas, potentially compromising both structural integrity and enzymatic activity. To minimize aggregation during storage, the recommended protocol includes maintaining the protein in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 or in a Tris-based buffer with 50% glycerol . When aggregation occurs despite these precautions, several rescue strategies can be implemented. Gentle sonication (3-5 short pulses) may disrupt early-stage aggregates without denaturing the protein. The addition of mild detergents (0.01-0.05% Tween-20) can sometimes redissolve protein aggregates while maintaining functional conformation.

For prevention of aggregation during experimental procedures, researchers should consider buffer optimization through thermal shift assays to identify stabilizing conditions. The addition of reducing agents such as DTT (1-5 mM) may help maintain sulfhydryl groups in their reduced state if oxidation contributes to aggregation. Size-exclusion chromatography can separate monomeric protein from aggregated species, though yield will be reduced. In cases where aggregation persists, exploring alternative fusion tags beyond the standard His-tag may improve solubility. Finally, researchers should implement quality control measures such as dynamic light scattering to monitor the aggregation state before conducting functional experiments, as the presence of aggregates can significantly skew activity measurements and interaction studies.

What imaging techniques best visualize Bifunctional protein aas cellular localization?

Visualizing the cellular localization of Bifunctional protein aas requires specialized imaging techniques that preserve both protein function and cellular architecture. Fluorescence microscopy using click chemistry represents an optimal approach, particularly when employing azide-containing metabolic labels conjugated to fluorophores like FAM alkyne or DBCO-Cy5 . This technique allows for specific labeling of the protein while minimizing background signal. For optimal results, researchers should titrate the azide monosaccharide concentration between 100-500 μg/ml to determine the minimum concentration yielding detectable signal . Flow cytometry can complement microscopy by providing quantitative analysis of labeling efficiency across cell populations.

For higher resolution imaging, super-resolution microscopy techniques such as STORM (Stochastic Optical Reconstruction Microscopy) or PALM (Photoactivated Localization Microscopy) can resolve protein localization beyond the diffraction limit. These approaches require specialized fluorophores with appropriate photoswitching properties. For dynamic studies tracking protein movement over time, researchers can implement FRAP (Fluorescence Recovery After Photobleaching) experiments using GFP-tagged versions of the protein, though care must be taken to verify that the GFP fusion doesn't alter localization patterns. Correlative light and electron microscopy (CLEM) offers the advantage of combining functional fluorescence imaging with ultrastructural context. This multi-modal imaging approach is particularly valuable when studying membrane-associated functions of the Bifunctional protein aas, allowing researchers to correlate protein localization with specific cellular compartments and membrane domains.

What statistical approaches are recommended for analyzing Bifunctional protein aas activity data?

Analyzing data from Bifunctional protein aas activity assays requires robust statistical approaches that account for the protein's dual functionality and potential variability between experimental preparations. When conducting enzyme kinetic studies, researchers should employ nonlinear regression analysis to determine key parameters such as Km and Vmax for each catalytic function. Multiple technical replicates (minimum n=3) and biological replicates (different protein preparations, minimum n=3) are essential for establishing statistical significance. Analysis of variance (ANOVA) with appropriate post-hoc tests (such as Tukey's HSD) should be used when comparing activity across multiple experimental conditions.

For imaging-based experiments using fluorescence microscopy and FACS analysis of labeled cells, quantification should include mean fluorescence intensity measurements alongside distribution analysis . When analyzing protein-substrate interactions, binding curves should be fitted using appropriate models (one-site or two-site binding) with residual analysis to validate model selection. Researchers should implement Bland-Altman plots when comparing different analytical methods for measuring the same parameter to identify systematic biases. For complex datasets integrating multiple experimental approaches, principal component analysis can help identify patterns and relationships between variables. All statistical analyses should include appropriate controls, and p-values should be adjusted for multiple comparisons when applicable to maintain statistical rigor.

How should researchers interpret discrepancies between in vitro and in vivo activity measurements?

Discrepancies between in vitro and in vivo activity measurements of Bifunctional protein aas reflect the complexity of cellular environments compared to purified systems. When interpreting such differences, researchers should consider several methodological factors. First, the recombinant protein's N-terminal His-tag may influence activity differently in purified versus cellular contexts . In vitro studies typically employ optimal buffer conditions (Tris/PBS-based buffer, pH 8.0) that may not reflect the variable cellular microenvironments where the protein functions. The presence of cellular binding partners, regulators, and competitive substrates can significantly alter apparent enzyme kinetics in vivo.

To reconcile these differences, researchers should implement validation strategies such as creating concentration gradients of potential regulatory factors in in vitro assays to mimic cellular conditions. Comparing wild-type protein with site-directed mutants both in vitro and in vivo can identify specific residues whose function depends on cellular context. Time-course studies may reveal that apparent discrepancies result from different measurement timeframes rather than fundamental mechanistic differences. Metabolic labeling with fluorescent tags followed by microscopy and flow cytometry can provide spatial information about where the protein is most active within cells . Researchers should recognize that differences between in vitro and in vivo measurements often represent biologically relevant regulation rather than experimental artifacts, potentially revealing novel regulatory mechanisms governing this bifunctional protein's activity that would be missed by in vitro studies alone.