Recombinant Escherichia coli O9:H4 Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Escherichia coli O9:H4 Cardiolipin Synthase (Cls)

Recombinant Escherichia coli O9:H4 Cardiolipin synthase (Cls) is an enzyme that catalyzes the synthesis of cardiolipin in Escherichia coli . Cardiolipin is a unique dimeric phospholipid primarily located in the inner mitochondrial membrane of eukaryotes and the bacterial plasma membrane of prokaryotes . In E. coli, cardiolipin synthase (Cls) facilitates the transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in cardiolipin and glycerol . The enzyme is encoded by the cls gene, situated at minute 28.02 on the E. coli genetic map .

Function and Mechanism

E. coli cardiolipin synthase converts two phosphatidylglycerol molecules into cardiolipin and glycerol . The enzyme uses a mixed micelle assay in which phosphatidyl[2-3H]glycerol acts as the substrate . Cardiolipin synthase activity is stimulated by phosphate and Triton X-100 .

Production and Purification

Recombinant DNA technology allows for the amplification and purification of cardiolipin synthase . For example, the cls gene can be inserted downstream from a T7 RNA promoter in a recombinant plasmid, such as pLR3 . When this plasmid is introduced into E. coli strain BL21(DE3), the resulting strain, BL21(DE3)/pLR3, exhibits significantly elevated cardiolipin synthase activity compared to wild-type cells . The enzyme can be purified to homogeneity through extraction with Triton X-114 and chromatography on DEAE-cellulose .

Biological Significance

Mutations in the cls gene can lead to several phenotypic changes in E. coli, including longer doubling times, decreased viability during the stationary phase, increased resistance to 3,4-dihydroxybutyl-1-phosphonate, and altered sensitivity to novobiocin . Cardiolipin synthase binds to anionic phospholipids, especially cardiolipin, which inhibits its phosphotransfer activity . Cardiolipin inhibition of cardiolipin synthase likely plays an important role in regulating cardiolipin synthesis in E. coli .

Applications

Recombinant E. coli O9:H4 Cardiolipin synthase (Cls) is available for purchase for research purposes . It is produced in an in vitro E. coli expression system with high purity and is commonly used in studies related to lipid metabolism and enzyme regulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
clsA; cls; EcHS_A1358; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function

Function: Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.