Recombinant Escherichia coli O9:H4 Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview

CobS (EC 6.3.5.11) is a cobalamin synthase that catalyzes the final steps of vitamin B₁₂ biosynthesis by attaching 5,6-dimethylbenzimidazole (DMB) or alternative bases to the corrin ring. In recombinant systems, CobS is typically expressed with affinity tags (e.g., His-tag) for purification and functional studies .

Key Properties

PropertyDescription
Molecular Weight~28 kDa (theoretical for E. coli O157:H7 CobS)
Gene LocuscobS (B5YSS1 in E. coli O157:H7)
Expression SystemHeterologously expressed in E. coli BL21(DE3) or similar strains
Structural FeaturesPredicted transmembrane domains; requires cobalt transporters for activity

Role in Cobalamin Biosynthesis

CobS operates in the nucleotide loop assembly (NLA) pathway:

  1. Substrates: Adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-5′-phosphate .

  2. Reaction: Condenses AdoCbi-GDP with α-ribazole-5′-phosphate to form adenosylcobalamin-5′-phosphate (AdoCbl-P) .

  3. Dephosphorylation: CobC phosphatase converts AdoCbl-P to active adenosylcobalamin .

Pathway Bottlenecks:

  • Cobalt chelation efficiency (dependent on CbiMNQO transporters) .

  • CobS overexpression disrupts membrane potential (Δψ), requiring compensatory proteins like PspA .

Key Issues

  • Membrane Instability: Overexpression of CobS in E. coli dissipates the proton motive force (PMF), leading to cell death .

  • Cofactor Dependency: Requires coexpression of cobalt transporters (CbiMNQO) and CobC phosphatase for full activity .

Solutions

StrategyOutcome
Coexpression with cobCRestores PMF by dephosphorylating AdoCbl-P .
Coexpression with pspAStabilizes membranes under PMF stress .
Modular Pathway EngineeringIncreases vitamin B₁₂ yield by 250-fold (307 µg/g DCW in optimized strains) .

In Vitro Activity

  • CobS Specific Activity: 8–22 nmol·min⁻¹·mg⁻¹ in Salmonella typhimurium extracts .

  • Substrate Flexibility: Vibrio CobS homologs show remodeling activity, attaching non-native bases to corrinoids .

Key Findings

Study SystemResult
S. typhimurium CobSSynthesizes AdoCbl-P from AdoCbi-GDP and α-ribazole-5′-P .
E. coli O157:H7 CobSPurified His-tagged enzyme retains activity in liposome assays .

Applications and Research Implications

  • Industrial B₁₂ Production: Engineered E. coli strains with heterologous cobS achieve high-yield B₁₂ synthesis (307 µg/g DCW) .

  • Biotechnological Tools: Recombinant CobS enables in vitro synthesis of novel cobamides for metabolic studies .

Unresolved Questions

  • Serotype-Specific Differences: No direct data on O9:H4 CobS; structural predictions rely on O157:H7 homologs .

  • Mechanistic Details: How CobS interacts with CobC/CbiB in membrane-anchored complexes remains unclear .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobS; EcHS_A2115; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
cobS
Target Protein Sequence
MSKLFWAMLSFITRLPVPRRWSQGLDFEHYSRGIITFPLIGLLLGAISGLVFMVLQAWCG VPLAALFSVLVLALMTGGFHLDGLADTCDGVFSARSRDRMLEIMRDSRLGTHGGLALIFV VLAKILVLSELALRGEPILASLAAACAVSRGTAALLMYRHRYAREEGLGNVFIGKIDGRQ TCVTLGLAAIFAAVLLPGMHGVAAMVVTMVAIFILGQLLKRTLGGQTGDTLGAAIELGEL VFLLALL
Uniprot No.

Target Background

Function
Recombinant *Escherichia coli* O9:H4 Cobalamin synthase (CobS) catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and what is its role in vitamin B12 biosynthesis?

Cobalamin synthase (cobS) is a critical enzyme in the vitamin B12 (cobalamin) biosynthetic pathway. It catalyzes one of the final steps in the assembly of the complete cobalamin molecule. Specifically, cobS is responsible for the attachment of the upper ligand to the cobalt center of the corrin ring structure. This enzyme is classified under EC 2.-.-.- as indicated in the protein annotation .

The protein functions as part of a complex pathway involving multiple enzymes that coordinate the synthesis of this structurally complex cofactor. In E. coli O9:H4, the full-length cobS protein consists of 247 amino acids and contains several transmembrane domains, as evidenced by the hydrophobic regions in its amino acid sequence . The protein's membrane association is consistent with its role in the final assembly of cobalamin, which involves coordinated actions across cellular compartments.

How should recombinant cobS be stored to maintain optimal activity?

Based on manufacturer recommendations and standard practices for recombinant proteins, the following storage conditions are optimal for maintaining cobS activity :

Storage ConditionRecommendation
Short-term (1 week)4°C
Medium-term-20°C in storage buffer
Long-term-80°C in storage buffer with 50% glycerol
Buffer compositionTris-based buffer optimized for protein stability

It is critical to avoid repeated freeze-thaw cycles as these can significantly reduce enzyme activity. The recommendation is to prepare working aliquots that can be stored at 4°C for up to one week . For reconstitution of lyophilized protein, sterile deionized water should be used to achieve a concentration of 0.1-1.0 mg/mL, followed by the addition of glycerol to a final concentration of 5-50% for extended storage.

What expression systems are most effective for producing active recombinant cobS protein?

E. coli remains the most commonly used expression system for recombinant proteins in research laboratories, including for the production of proteins like cobS . When designing expression systems for cobS, researchers should consider several factors that have been identified in recent studies on recombinant protein production:

  • Promoter selection: The T7 RNA polymerase system, commonly used in pET plasmids, provides high-level expression but requires careful optimization to prevent metabolic burden .

  • Codon optimization: Adjusting codons to match E. coli preferences can significantly improve expression levels, particularly for membrane proteins like cobS.

  • Fusion tags: N-terminal tags (such as the 6xHis tag commonly used for cobS) facilitate purification while minimally affecting function .

  • Host strain selection: Specialized E. coli strains with enhanced membrane protein expression capabilities or rare codon supplementation may improve cobS yields.

  • Growth conditions: Lower temperatures (16-25°C) during induction often improve the solubility and correct folding of membrane proteins like cobS.

Recent advances have addressed several bottlenecks in E. coli expression systems, including improved control of translation processes to achieve maximal yields of functional exogenous proteins .

What assays can be used to measure cobS activity in experimental settings?

Several complementary approaches can be employed to assess cobS enzymatic activity:

  • HPLC-based assays: High-performance liquid chromatography coupled with UV-visible detection can monitor the conversion of precursor molecules to cobalamin. This method allows for quantitative analysis of reaction products.

  • Spectrophotometric assays: Changes in absorption spectra during the cobS-catalyzed reaction can be monitored at specific wavelengths characteristic of cobalamin intermediates and products.

  • Radioactive labeling: Using isotope-labeled precursors can help track the incorporation of specific components into the final cobalamin structure, allowing for sensitive detection of cobS activity.

  • Mass spectrometry: LC-MS/MS can provide detailed structural information about reaction intermediates and products, offering insights into the catalytic mechanism.

  • Coupled enzyme assays: cobS activity can be linked to the function of cobalamin-dependent enzymes like methionine synthase, which requires properly synthesized cobalamin for activity .

When designing these assays, researchers should consider the complex nature of cobalamin synthesis and the potential need for additional cofactors or enzymes to support cobS function in vitro.

How can researchers troubleshoot issues with recombinant cobS expression and purification?

Common challenges in cobS expression and purification include poor solubility, low yield, and loss of activity. The following troubleshooting approaches can help address these issues:

  • Solubility challenges:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Use specialized strains designed for membrane protein expression

    • Include solubilizing agents or detergents appropriate for membrane proteins

    • Consider fusion partners that enhance solubility

  • Low expression yield:

    • Optimize codon usage for E. coli

    • Adjust media composition to include trace elements needed for cobS folding

    • Control expression rate through careful promoter selection

    • Balance metabolic burden through co-expression of chaperones

    • Recent advances suggest that controlling translation process is crucial for maximal yields

  • Purification difficulties:

    • Optimize detergent type and concentration for membrane protein extraction

    • Consider native purification conditions to maintain protein-protein interactions

    • Use affinity chromatography with careful optimization of binding and elution conditions

    • Implement multi-step purification protocols to improve purity while minimizing activity loss

    • For cobS specifically, the 6xHis tag approach has proven effective

  • Activity loss during purification:

    • Add stabilizing agents (glycerol, reducing agents) to purification buffers

    • Minimize time between purification steps

    • Consider purification under anaerobic conditions if oxygen sensitivity is suspected

    • Maintain appropriate pH and ionic strength throughout the purification process

How does cobS interact with other proteins in the cobalamin synthesis pathway?

Cobalamin biosynthesis is a complex process involving numerous enzymatic steps and protein-protein interactions. The following points highlight key interactions and methodological approaches to study them:

  • Pathway integration: cobS functions within a larger pathway of cobalamin synthesis, receiving substrates from upstream enzymes and potentially participating in enzyme complexes. Studies using pull-down assays and co-immunoprecipitation can identify direct protein-protein interactions.

  • Membrane association: The transmembrane nature of cobS (evident from its amino acid sequence ) suggests localization that facilitates interactions with other membrane-associated components of the pathway. Techniques such as blue native PAGE and membrane fractionation can help identify these associations.

  • Cofactor transfer: The synthesis of cobalamin involves the coordinated transfer of intermediates between enzymes. Fluorescence resonance energy transfer (FRET) and isotope labeling experiments can track these transfers in real-time.

  • Regulatory interactions: Recent advances in understanding E. coli recombinant protein production suggest that translation control is crucial for optimal expression . Similar regulatory mechanisms may apply to native cobS expression, involving interactions with transcriptional and translational machinery.

  • Methodological approaches: To study these interactions, researchers can employ techniques such as:

    • Bacterial two-hybrid screening

    • Co-expression followed by affinity purification

    • Cross-linking coupled with mass spectrometry

    • Surface plasmon resonance to measure binding kinetics

    • Cryo-electron microscopy to visualize multiprotein complexes

What are the molecular mechanisms of cobS catalysis and how can they be investigated?

The catalytic mechanism of cobS involves several sophisticated molecular events that can be investigated through multiple experimental approaches:

  • Structural analysis: While the complete structure of cobS has not been fully determined, structural studies of related enzymes provide insights into potential catalytic mechanisms. For example, the high-resolution structure of cobalamin-dependent methionine synthase reveals critical interactions with the cobalamin cofactor .

  • Active site identification: Site-directed mutagenesis of conserved residues can help identify the amino acids critical for cobS catalytic activity. Key targets would include residues that coordinate metal ions or participate in substrate binding.

  • Intermediate trapping: The cobS reaction likely proceeds through multiple intermediates. These can be trapped by:

    • Using substrate analogs that block specific steps

    • Employing rapid-quench techniques to freeze the reaction at different timepoints

    • Developing specialized spectroscopic methods to detect transient species

  • Computational approaches: Molecular dynamics simulations and quantum mechanical/molecular mechanical (QM/MM) calculations can model the catalytic events at an atomic level, generating hypotheses that can be tested experimentally.

  • Kinetic analysis: Detailed kinetic studies using varied substrate concentrations and conditions can provide information about the reaction mechanism, including:

    • Order of substrate binding

    • Rate-limiting steps

    • Allosteric regulation

    • Inhibition patterns

These mechanistic investigations are particularly important given the complex nature of cobalamin synthesis and the potential for developing targeted interventions to modulate this pathway.

How do variations in cobS sequence across bacterial species affect cobalamin synthesis capacity?

Comparative analysis of cobS sequences and activities across different bacterial species reveals important insights into functional conservation and specialization:

  • Sequence diversity: While the core catalytic domain of cobS is conserved, significant variations exist across bacterial species. For example, the presence of cobS in non-tuberculous mycobacteria contrasts with its apparent functional differences in Mycobacterium tuberculosis .

  • Functional consequences: These sequence variations lead to differences in:

    • Substrate specificity

    • Catalytic efficiency

    • Regulation mechanisms

    • Environmental adaptations

  • Methodological approaches for comparative studies:

    • Phylogenetic analysis to identify conserved and variable regions

    • Heterologous expression of cobS variants to compare activities

    • Chimeric proteins to identify functional domains

    • Structural modeling to predict effects of sequence variations

    • Site-directed mutagenesis to test specific residue contributions

  • Evolutionary implications: The pattern of cobS sequence conservation provides insights into the evolutionary history of cobalamin synthesis. Some bacterial lineages have maintained full synthesis capacity, while others have evolved to rely on uptake mechanisms.

  • Research applications: Understanding these variations can guide:

    • Engineering of cobS for improved catalytic properties

    • Development of species-specific inhibitors

    • Prediction of cobalamin synthesis capacity in uncharacterized bacterial species

A comparative table of key cobS features across selected bacterial species would include conservation of catalytic residues, membrane topology, and experimentally determined activity levels.

What are the major challenges in studying cobS function in vitro versus in vivo?

Researchers face several distinct challenges when studying cobS function in different experimental contexts:

Challenge AreaIn Vitro ChallengesIn Vivo ChallengesEmerging Solutions
Protein stabilityMaintaining membrane protein stability outside native environmentDistinguishing cobS activity from other pathway enzymesNanodiscs and liposome reconstitution systems
Cofactor requirementsIdentifying and providing all necessary cofactorsMetabolic complexity affecting cofactor availabilityCoupled enzyme systems and reconstituted pathways
Reaction conditionsEstablishing physiologically relevant conditionsControlling cellular metabolic stateMicrofluidic systems with controlled environments
Detection sensitivityLow turnover rates requiring sensitive detectionBackground cellular activityAdvanced mass spectrometry and isotope labeling
Regulatory factorsUnknown regulatory moleculesComplex regulatory networksSystematic depletion studies and multi-omics approaches

How can isotope labeling be used to track cobalamin synthesis mediated by cobS?

Isotope labeling provides powerful tools for tracking the complex synthesis of cobalamin through the enzymatic activity of cobS:

  • Precursor labeling strategies:

    • ¹³C-labeled precursors can track carbon incorporation into the corrin ring

    • ¹⁵N-labeled precursors can monitor nitrogen incorporation

    • ³⁴S or ³⁵S labeling can follow sulfur atoms in specific positions

    • ⁵⁷Co can specifically track the central cobalt atom

  • Pulse-chase experiments:

    • Add labeled precursors at specific timepoints

    • Chase with unlabeled precursors

    • Sample at intervals to track incorporation and turnover

    • This approach reveals the kinetics of different synthesis steps

  • Analysis methods:

    • Mass spectrometry to detect isotope incorporation patterns

    • NMR spectroscopy for structural confirmation

    • Scintillation counting for radioactive isotopes

    • Techniques such as ICP-MS for metal isotope detection

  • In vivo applications:

    • Whole-cell isotope labeling to track pathway activity

    • Competition experiments with unlabeled precursors

    • Metabolic flux analysis to quantify pathway dynamics

  • Technical considerations:

    • Isotope dilution effects

    • Potential isotope effects on reaction rates

    • Background incorporation into other cellular components

    • Need for specialized detection methods

This approach is particularly valuable for studying the cobalamin synthesis pathway, which involves multiple enzymatic steps and intermediate transfers that can be difficult to track by other means.

What artificial intelligence approaches show promise for improving cobS research?

Artificial intelligence (AI) tools are emerging as valuable resources for addressing complex research questions in protein biochemistry, including the study of cobS:

  • Structural prediction:

    • AI-based tools like AlphaFold2 can predict protein structures with high accuracy

    • These predictions can reveal cobS binding sites and catalytic residues

    • Multiple sequence alignments coupled with AI can identify functionally important regions

  • Reaction mechanism prediction:

    • Machine learning algorithms can propose catalytic mechanisms based on similar enzymes

    • Quantum mechanical calculations guided by AI can model transition states

    • These approaches may help resolve contradictions in experimental results

  • Experimental design optimization:

    • AI can help design optimal expression constructs

    • Machine learning can predict protein solubility and stability

    • Automated laboratory systems guided by AI can systematically test conditions

  • Data integration:

    • AI can integrate diverse datasets (transcriptomics, proteomics, metabolomics)

    • This integration can reveal patterns in complex metabolic networks

    • Network analysis can identify key regulatory points affecting cobS function

Recent reviews suggest that while AI tools show great promise for clarifying issues like metabolic burden in recombinant protein production, the training phase will require more systematic experimental approaches to collect sufficiently uniform data . This highlights the continued importance of careful experimental design alongside computational advances.

What emerging technologies could advance our understanding of cobS function?

Several cutting-edge technologies show particular promise for deepening our understanding of cobS function:

  • Cryo-electron microscopy: This technique could reveal the detailed structure of cobS in its membrane environment, potentially capturing different conformational states during catalysis.

  • Single-molecule enzymology: Observing individual cobS molecules during catalysis could reveal heterogeneity in enzyme behavior and identify rare or transient states not detectable in bulk assays.

  • Microfluidics and droplet-based assays: These approaches allow high-throughput screening of cobS variants or reaction conditions with minimal sample consumption.

  • Synthetic biology approaches: Reconstituting minimal cobalamin synthesis pathways in artificial systems could isolate cobS function from confounding cellular factors.

  • CRISPR-based genome editing: Precise modification of cobS and related genes in their native context can reveal physiological roles and regulatory networks.

  • Time-resolved structural methods: Techniques like time-resolved X-ray crystallography or spectroscopy could capture the enzyme during catalysis, revealing dynamic structural changes.

As noted in recent reviews, these advanced technologies, combined with artificial intelligence tools, could help clarify critical questions about enzyme function that remain elusive due to contradictory experimental results .

How might cobS research contribute to broader understanding of vitamin B12 metabolism disorders?

Research on cobS has implications that extend beyond basic enzymology to human health applications:

  • Understanding vitamin B12 deficiency: Clarifying the biosynthetic pathway can help explain why certain organisms can synthesize cobalamin while others, including humans, cannot. This has implications for managing vitamin B12 deficiency disorders.

  • Microbial ecology insights: Differences in cobS function across bacterial species, such as those observed between non-tuberculous mycobacteria and M. tuberculosis , provide insights into how vitamin B12 metabolism shapes microbial communities in various environments, including the human microbiome.

  • Biomarker development: Understanding the complete pathway of cobalamin synthesis could lead to improved biomarkers for vitamin B12 status, potentially identifying metabolic intermediates that indicate specific pathway disruptions.

  • Therapeutic development: Selective inhibition of bacterial cobS could provide antimicrobial strategies that target pathogens without disrupting beneficial microbiota.

  • Metabolic engineering applications: Enhanced understanding of cobS function could enable engineering of bacterial strains for improved vitamin B12 production, addressing nutritional deficiencies.

The intricate connection between cobS function and methionine synthase activity further highlights the importance of cobalamin synthesis for fundamental cellular processes including DNA methylation and amino acid metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.