Recombinant Escherichia coli O9:H4 Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

RnfE is a subunit of the Rnf (Rhodobacter nitrogen fixation) complex, which facilitates electron transfer between cellular redox components. In E. coli O9:H4, the Rnf complex contributes to energy conservation by coupling electron transport to ion translocation across membranes .

PropertyDetails
Gene NamernfE (also termed rsxE in some strains)
Protein NameElectron Transport Complex Protein RnfE
OrganismEscherichia coli O9:H4 (strain HS)
Uniprot IDA8A0H5
Sequence Length231 amino acids (full-length)
Structural FeaturesTransmembrane domains, conserved residues for ion/electron transfer

Recombinant Production and Purification

RnfE is produced recombinantly in E. coli expression systems, often fused with affinity tags (e.g., N-terminal His-tag) to simplify purification . Key production parameters include:

ParameterSpecification
Expression SystemE. coli in vitro expression
TagHis-tag (varies by construct)
Purity≥85% (verified by SDS-PAGE)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions–20°C (short-term); –80°C (long-term); avoid freeze-thaw cycles

Research Applications

RnfE is utilized in biochemical and structural studies to investigate bacterial electron transport mechanisms. Commercial sources highlight its use in:

  • Enzyme Activity Assays: Studying ion-coupled electron transport .

  • Antibody Production: Immunogen for generating anti-RnfE antibodies .

  • Structural Biology: Crystallization trials for mapping transmembrane domains .

ApplicationDetails
Western Blot (WB)Used to detect RnfE in bacterial lysates
ELISAQuantification of RnfE in experimental samples
Functional StudiesRole in NADH:ferredoxin oxidoreductase activity

Comparative Analysis with Homologs

RnfE homologs exist across bacterial species, but the E. coli O9:H4 variant shows unique adaptations:

SpeciesKey Differences
Salmonella gallinarumLower thermal stability; divergent transmembrane regions
Shewanella oneidensisEnhanced redox activity due to modified active-site residues
E. coli O7:K198% sequence similarity; identical ion-binding motifs

Technical Challenges and Solutions

  • Instability in Solution: Additives like glycerol (50%) and Tris buffer mitigate aggregation .

  • Low Yield: Optimized codon usage and induction conditions (e.g., IPTG concentration) improve expression .

  • Export Competition: CRISPRi-based repression of polysaccharide transporters enhances intracellular retention of recombinant RnfE .

Future Research Directions

  • Mechanistic Studies: Elucidate RnfE’s role in coupling electron transport to sodium/proton gradients .

  • Biotechnological Applications: Engineer RnfE for bioenergy applications (e.g., microbial fuel cells) .

  • Pathogenicity Links: Investigate RnfE’s contribution to E. coli O9:H4 virulence in host models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; rnfE; EcHS_A1708; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV
Uniprot No.

Target Background

Function
This protein is part of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the RnfE protein and what is its function in E. coli O9:H4?

RnfE is a component of the Rnf (Rhodobacter nitrogen fixation) complex, a membrane-bound electron transport system found in various bacteria including specific strains of E. coli. The Rnf complex functions as an ion-pumping ferredoxin:NAD+ oxidoreductase, coupling the oxidation of ferredoxin with the reduction of NAD+ while generating a sodium or proton gradient across the membrane for energy conservation.

In E. coli O9:H4 specifically, the RnfE protein contains iron-sulfur clusters that facilitate electron transfer within the complex. This electron transport function is particularly important under anaerobic or microaerobic conditions, where the Rnf complex contributes to maintaining redox balance and energy conservation through alternative pathways. The protein plays a crucial role in the adaptability of E. coli to varying environmental conditions by modulating electron flow during cellular respiration.

What expression systems are most effective for producing recombinant RnfE protein?

While various expression systems can be employed for recombinant RnfE production, E. coli-based systems remain the most widely used due to their well-established protocols, rapid growth, and cost-effectiveness. The most effective systems incorporate several key features:

  • Expression vectors with tightly regulated promoters (T7, araBAD) to control protein expression levels

  • Specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

  • Fusion tags that enhance solubility and facilitate purification

  • Codon-optimized sequences, particularly at the N-terminus

Recent research has shown that directed evolution approaches using fluorescence-activated cell sorting (FACS) can substantially improve expression levels. By fusing RnfE to GFP and screening libraries with modified N-terminal sequences, researchers have achieved up to 30-fold increases in protein production yields . This approach has proven particularly valuable for membrane proteins like RnfE that traditionally present expression challenges.

How can the functionality of recombinant RnfE be verified after expression?

Verifying the functionality of recombinant RnfE requires a multi-faceted approach that addresses both structural integrity and electron transport capability:

  • Spectroscopic analysis: UV-visible and EPR spectroscopy can confirm the presence and proper incorporation of iron-sulfur clusters, essential for electron transport function.

  • Membrane integration: Western blotting of membrane fractions and protease accessibility assays can verify proper membrane insertion and orientation.

  • Electron transport assays: Measuring the ability to transfer electrons between appropriate donors (reduced ferredoxin) and acceptors (NAD+) using spectrophotometric methods that track changes in absorbance at specific wavelengths (typically 340 nm for NAD+/NADH).

  • Reconstitution studies: Incorporating purified RnfE into liposomes or nanodiscs to reconstitute electron transport activity in a controlled membrane environment.

  • Complementation assays: Testing whether the recombinant RnfE can restore function in rnfE-deficient strains under conditions where the Rnf complex is required for growth.

Similar to methodologies used in studying electron transport in other systems, researchers can employ specialized techniques to measure electron flow at the molecular level . These approaches provide quantitative measures of functionality that go beyond simple expression verification.

How can N-terminal sequence optimization enhance RnfE expression in recombinant systems?

The nucleotides immediately following the start codon significantly influence recombinant protein expression in E. coli, with particularly strong effects observed for membrane proteins like RnfE. Traditional approaches relied on limited rational design, but modern methods employ large-scale screening of diversified sequences:

  • Library creation: Generating DNA libraries coding for diverse N-terminal sequences (typically the first 10-15 codons) of the RnfE protein.

  • Reporter fusion: Fusing these variants to a reporter protein like GFP to enable high-throughput screening.

  • FACS-based selection: Using fluorescence-activated cell sorting to identify and isolate cells expressing high levels of the fusion protein.

  • Sequence analysis: Analyzing selected high-expressing variants to identify beneficial sequence patterns.

What are the most effective strategies for purifying functional RnfE while maintaining its electron transport activity?

Purifying membrane proteins like RnfE while preserving their function presents significant challenges. The most effective strategies balance extraction efficiency with preservation of structural integrity:

  • Gentle solubilization: Using mild detergents like n-dodecyl-β-D-maltoside (DDM), digitonin, or amphipols that effectively extract membrane proteins while maintaining native-like environments around transmembrane regions.

  • Affinity chromatography: Incorporating affinity tags (His6, Strep-tag) at non-critical regions of RnfE to enable selective purification with minimal functional impact.

  • Anaerobic handling: Performing purification steps under anaerobic conditions to prevent oxidative damage to the iron-sulfur clusters essential for electron transport.

  • Stability enhancers: Including glycerol, specific lipids, and reducing agents in purification buffers to maintain protein stability.

  • Magnetic separation techniques: For iron-containing proteins like RnfE, magnetic nanoparticle-based purification methods offer advantages by exploiting the magnetic properties of iron-sulfur clusters .

Purification MethodRelative YieldFunctional RetentionTechnical ComplexityKey Advantages
Detergent solubilization + Ni-NTA chromatographyHighMediumLowStandard approach, widely accessible
Amphipol exchange + Size exclusionMediumHighMediumBetter structural preservation
Nanodisc reconstitutionLowVery HighHighNative-like membrane environment
Magnetic nanoparticle separationMediumHighMediumSelective for iron-containing proteins

The choice of purification strategy should align with the intended downstream applications, balancing yield requirements with the need for functional integrity.

How do mutations in key residues of RnfE affect electron transport capabilities?

Site-directed mutagenesis studies have revealed several critical residues in RnfE that impact electron transport function:

Similar to studies on electron transport in other systems, design and control experiments involving single molecules have demonstrated that small structural changes can significantly alter electron transport behaviors . These findings provide valuable insights for protein engineering efforts aimed at modifying RnfE function for specific applications.

What are the optimal growth conditions for maximizing functional RnfE expression in recombinant E. coli systems?

Optimizing growth conditions is crucial for balancing protein expression levels with proper folding and assembly of complex membrane proteins like RnfE:

  • Temperature management: Growth at 30°C until induction, followed by expression at 18-25°C rather than 37°C, significantly improves the yield of properly folded RnfE by slowing protein synthesis and allowing time for proper insertion into membranes.

  • Media composition: Enriched media (TB, 2xYT) supplemented with trace elements, particularly iron and sulfur sources, support the formation of iron-sulfur clusters essential for RnfE function.

  • Induction parameters: Lower inducer concentrations (0.1-0.3 mM IPTG or 0.002-0.02% arabinose) with extended expression times (16-24 hours) favor proper folding over rapid accumulation.

  • Aeration control: Semi-aerobic or microaerobic conditions often improve expression of functional RnfE by better mimicking its native environment and reducing oxidative stress.

  • Supplementation strategies: Adding specific membrane components (phospholipids), iron sources (ferric citrate), and sulfur sources (cysteine) to the growth medium can enhance the assembly of functional protein.

These optimized conditions have been shown to increase the yield of functional RnfE by 3-5 fold compared to standard E. coli expression protocols, while maintaining electron transport activity.

How can I measure electron transport activity of recombinant RnfE in vitro?

Measuring the electron transport activity of RnfE requires specialized assays that can capture its role in electron transfer:

  • Spectrophotometric assays: Monitoring the reduction of electron acceptors (NAD+) or oxidation of electron donors (reduced ferredoxin) by tracking absorbance changes at characteristic wavelengths (340 nm for NAD+/NADH).

  • Artificial electron acceptor/donor assays: Using artificial electron acceptors like ferricyanide or electron donors like reduced methyl viologen that exhibit clear spectroscopic changes upon redox reactions.

  • Oxygen consumption measurements: For coupled systems, measuring oxygen consumption rates using Clark-type electrodes can indirectly assess electron transport activity.

  • Membrane potential monitoring: Using voltage-sensitive dyes or ion-selective electrodes to measure the membrane potential or ion gradients generated by RnfE activity.

  • Direct electrochemical methods: Protein film voltammetry and other electrochemical techniques allow direct measurement of electron transfer between RnfE and electrodes, providing detailed insights into redox properties.

Assay TypeDetection LimitTechnical ComplexityEquipment RequirementsKey Advantages
NAD+ reduction5-10 nmol/min/mgLowStandard spectrophotometerSimple, quantitative
Artificial acceptors2-5 nmol/min/mgLowStandard spectrophotometerHigher sensitivity
Oxygen consumption10-20 nmol/min/mgMediumOxygen electrodeMeasures coupled activity
Membrane potentialQualitativeMediumFluorimeterAssesses ion coupling
Electrochemical1-2 nmol/min/mgHighPotentiostat, electrodesDirect measurement

The choice of assay should be guided by the specific aspect of RnfE function being investigated and the available equipment.

What controls are essential when studying RnfE electron transport to ensure reliable results?

Rigorous controls are critical for accurate interpretation of RnfE functional studies:

  • Negative controls:

    • Membrane preparations from cells expressing an unrelated membrane protein

    • Heat-denatured RnfE samples to establish baseline for non-enzymatic reactions

    • RnfE variants with mutations in key functional residues

    • Reactions without essential components (electron donors/acceptors)

  • Positive controls:

    • Well-characterized electron transport proteins with similar functions

    • Purified respiratory complex components with established activities

    • Chemical systems that mimic specific aspects of electron transport

  • System controls:

    • Measurements at different protein concentrations to confirm linearity

    • Time-course experiments to establish reaction kinetics

    • pH and ionic strength variations to identify optimal conditions

    • Addition of specific inhibitors to confirm reaction specificity

  • Technical controls:

    • Multiple protein preparations to ensure reproducibility

    • Different purification methods to assess impact on activity

    • Various detergent types and concentrations for membrane protein studies

Implementing these controls helps distinguish genuine RnfE activity from artifacts and ensures that experimental conditions support proper protein function. Similar approaches are used in other electron transport studies to ensure reliability of results .

How can I differentiate between specific RnfE activity and background electron transport in complex systems?

Distinguishing RnfE-specific electron transport from background activities requires several complementary approaches:

  • Comparative analysis: Measuring activity in systems with and without RnfE expression, using isogenic strains that differ only in rnfE expression.

  • Inhibitor profiling: Using specific inhibitors of different electron transport pathways to isolate RnfE contribution. While RnfE lacks specific inhibitors, other respiratory chain components can be selectively blocked.

  • Substrate specificity: Exploiting the unique substrate preferences of RnfE by using ferredoxin or flavodoxin as electron donors, which are relatively specific to the Rnf complex.

  • Kinetic parameters: Determining Km and Vmax values for RnfE with various substrates, which can distinguish its activity from other electron transport components with different kinetic properties.

  • Genetic manipulation: Using CRISPR-Cas9 or other genome editing techniques to create precise knockouts or modifications of the rnfE gene and measuring the resulting changes in electron transport.

  • Reconstitution experiments: Purifying individual components and systematically reconstituting them to identify the specific contribution of RnfE to the observed activity.

By combining these approaches, researchers can confidently attribute observed electron transport activities to RnfE rather than to other cellular components with similar functions.

How should I interpret changes in RnfE electron transport activity under different experimental conditions?

Interpreting changes in RnfE activity requires consideration of multiple factors that affect electron transport:

  • Structural integrity: Changes in activity may reflect alterations in protein structure rather than catalytic efficiency. Complementary structural analyses (CD spectroscopy, thermal stability assays) can help distinguish between these possibilities.

  • Redox state effects: The redox environment significantly influences iron-sulfur proteins. Control experiments at different redox potentials help clarify whether activity changes reflect direct effects on RnfE or alterations in substrate redox states.

  • Membrane environment impacts: For membrane proteins like RnfE, the lipid environment strongly influences function. Changes in activity may reflect alterations in membrane properties rather than direct effects on the protein.

  • Complex assembly considerations: Since RnfE functions as part of a multi-protein complex, activity changes may reflect effects on complex assembly or stability rather than on the intrinsic properties of RnfE itself.

  • Coupled processes: The activity of RnfE is coupled to ion translocation across membranes. Conditions that affect membrane potential or ion gradients will indirectly impact measured electron transport rates.

What approaches can resolve contradictory results from different assay methods when studying RnfE?

When different assays yield contradictory results for RnfE activity, systematic troubleshooting is required:

  • Methodological validation: First confirm that all assays are properly executed using appropriate standards and controls. Different sensitivity and specificity levels across assays can create apparent contradictions.

  • Condition mapping: Systematically vary experimental parameters (pH, ionic strength, temperature) to identify conditions where assay results converge or where divergences are most pronounced.

  • Component analysis: Investigate whether additional components in complex mixtures are causing interference by testing purified systems and adding components sequentially.

  • Protein state assessment: Verify protein integrity across experiments using complementary methods (activity assays, spectroscopic measurements) to ensure that protein damage isn't causing discrepancies.

  • Mathematical modeling: Develop quantitative models that integrate results from multiple assays to identify parameter sets that can reconcile seemingly contradictory observations.

Similar approaches have been applied to resolve contradictions in other electron transport studies, where apparent discrepancies often reveal important insights about system properties once properly understood . The integration of data from multiple methods typically provides a more complete understanding than reliance on any single technique.

How can RnfE research contribute to the development of bioenergy applications?

Research on RnfE and similar electron transport proteins has significant implications for bioenergy applications:

  • Microbial fuel cells: Understanding RnfE's role in electron transport can inform the design of improved microbial fuel cells, where efficient transfer of electrons to electrodes is critical for power generation.

  • Bioelectrosynthesis: Engineered electron transport systems incorporating optimized RnfE variants could enhance production of fuels and chemicals in bioelectrosynthesis platforms.

  • Hydrogen production: Since the Rnf complex interacts with hydrogenases in some organisms, insights from RnfE research could improve biological hydrogen production systems.

  • Metabolic engineering: Modifying electron flow through RnfE could redirect cellular metabolism toward desired products by altering redox balance and energy conservation.

  • Synthetic biology: Designer electron transport chains incorporating engineered RnfE components could create novel bioelectronic interfaces for sensing and energy conversion.

The development of nanocomposite materials that interface with biological electron transport systems represents a particularly promising direction. Recent work on iron oxide nanocomposites synthesized by recombinant E. coli demonstrates the potential for creating hybrid materials with both biological and synthetic components for enhanced functionality .

What are the current limitations in RnfE research and how might they be addressed?

Despite significant progress, several challenges remain in RnfE research:

Addressing these limitations will require interdisciplinary approaches combining advanced biophysical techniques, computational modeling, and synthetic biology tools. The development of new methodologies for studying electron transport at the molecular level, similar to those described for single-molecule studies , could significantly advance the field.

What new experimental approaches are emerging for studying RnfE and similar electron transport proteins?

Several innovative approaches are transforming research on electron transport proteins like RnfE:

  • Single-molecule techniques: Adapting methods from physics and materials science to study electron transport in individual protein complexes provides unprecedented insights into heterogeneity and dynamics .

  • Artificial intelligence approaches: Machine learning algorithms are increasingly used to predict protein structure, function, and interactions, helping guide experimental design for complex systems like RnfE.

  • Microfluidic systems: Lab-on-a-chip approaches enable high-throughput screening of conditions and variants while minimizing sample requirements.

  • Optogenetic control: Light-activated components can be integrated into electron transport systems to provide temporal control and study dynamics with high precision.

  • In-cell NMR and EPR: Advanced spectroscopic techniques now allow characterization of proteins within their cellular environment, providing more physiologically relevant information.

  • Nanoscale electrochemistry: Developments in electrochemical techniques enable direct measurement of electron transfer at the nanoscale, relevant for understanding RnfE function.

  • Biosynthetic methods: Novel approaches using engineered bacteria to synthesize nanocomposites with electron transport proteins offer new ways to create functional hybrid materials .

These emerging methodologies, combined with established approaches, promise to significantly advance our understanding of RnfE and similar electron transport proteins in the coming years.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.