Recombinant Escherichia coli O9:H4 Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O9:H4 Fumarate Reductase Subunit C (frdC)

Escherichia coli O9:H4 Fumarate reductase subunit C (frdC) is a component of the fumarate reductase (FRD) enzyme complex in E. coli . FRD is an enzyme that catalyzes the reduction of fumarate to succinate, which is important in anaerobic respiration where fumarate acts as the terminal electron acceptor . The frdC subunit is a small, hydrophobic protein that anchors the catalytic subunits of the FRD complex to the cytoplasmic membrane and participates in electron transfer between the enzyme and quinones .

Function of Fumarate Reductase

Fumarate reductase (FRD) facilitates the reduction of fumarate to succinate, utilizing two electrons . Succinate dehydrogenase (SDH) catalyzes the reverse reaction, which is the oxidation of succinate to fumarate . SDH is involved in the tricarboxylic acid (TCA) cycle and the transfer of electrons to quinone in the respiratory chain .

Biological Functions of Fumarate Reductase/Succinate Dehydrogenase

FunctionDescription
Catalysis of Fumarate ReductionFRD catalyzes the reduction of fumarate to succinate, an important step in anaerobic respiration.
Anchoring Catalytic Subunits to the MembraneThe hydrophobic subunits FrdC and FrdD (in E. coli) are responsible for attaching the catalytic subunits (FrdA and FrdB) to the inner cytoplasmic membrane.
Electron Interchange with QuinonesFrdC and FrdD are essential for electron transfer between the enzyme, menaquinol, and ubiquinone.
Role in Campylobacter jejuni MetabolismIn C. jejuni, FRD is the sole succinate dehydrogenase and is crucial for the bacterium's growth and metabolism, especially under microaerobic conditions .
Involvement in Redox ReactionsFRD is involved in redox reactions, particularly in anaerobic conditions where it uses fumarate as a terminal electron acceptor.

Structure and Components

The FRD enzyme complex consists of four subunits: FrdA, FrdB, FrdC, and FrdD . FrdC and FrdD are small, hydrophobic subunits that anchor the catalytic subunits to the cytoplasmic membrane . In E. coli, FrdC is a 15 kDa protein . These subunits are essential for electron interchange between the enzyme, menaquinol, and ubiquinone .

Role of FrdC Subunit

The FrdC subunit is critical for the attachment of the catalytic subunits (FrdA and FrdB) to the inner surface of the cytoplasmic membrane . This is due to the hydrophobic nature of FrdC . It is involved in electron transfer between the enzyme and quinones, specifically menaquinone . Menaquinone is presumed to bind at two sites, QA and QB, as part of the FRD redox chain .

Functional Studies and Research Findings

Studies on fumarate reductase have provided insights into its catalytic mechanisms and subunit functions. Research has shown that specific amino acid residues in FrdA, such as histidine and arginine, play critical roles in the active site function . Mutations in FrdB, particularly Pro-159, can disrupt quinone binding sites, leading to enzyme inactivation .

Fumarate Reductase in Campylobacter jejuni

In Campylobacter jejuni, fumarate reductase (FrdCAB) functions as the sole succinate dehydrogenase . Mutants lacking FrdA are unable to perform succinate-dependent respiration, highlighting the importance of FRD in succinate metabolism in C. jejuni .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
frdC; EcHS_A4396; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function
Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the E. coli fumarate reductase complex?

Escherichia coli fumarate reductase is encoded by the frdABCD operon and consists of four subunits that form a functional complex. The enzyme allows E. coli to utilize fumarate as a terminal electron acceptor during anaerobic respiration. The FRD A and FRD B subunits form the catalytic dimer responsible for fumarate reduction, while FRD C and FRD D anchor the complex to the membrane and facilitate electron transfer from reduced quinones . The complete assembly of all four subunits is essential for growth under anaerobic conditions with fumarate as the terminal electron acceptor, and for the proper functioning of the electron transport chain .

How is the frdABCD operon regulated in E. coli?

The frdABCD operon exhibits complex regulation in response to environmental conditions:

  • Oxygen regulation: Expression increases approximately 10-fold under anaerobic conditions compared to aerobic growth .

  • Substrate induction: The presence of fumarate further increases expression by approximately 1.5-fold .

  • Alternate electron acceptor repression: Nitrate, a preferred electron acceptor, decreases expression by 23-fold .

  • FNR protein regulation: The FNR protein (encoded by the fnr gene) is responsible for anaerobic activation of the frd operon. Mutations in fnr impair anaerobic induction of frd expression .

  • Independent nitrate repression: Nitrate repression occurs under both aerobic and anaerobic conditions and functions independently of the FNR-mediated oxygen control mechanism .

What expression systems are commonly used for recombinant frdC production in E. coli?

Several expression systems can be employed for recombinant frdC production, each with advantages and limitations:

PromoterStrengthInduction MethodAdvantagesLimitations
PT7Very highIPTGHigh expression levels, tight regulationRequires special strains (DE3), potential toxic effects
Plac trcHighIPTGGood expression, works in most E. coli strainsSome basal expression
PtacHighIPTGGood expression, works in most E. coli strainsSome basal expression
PBADMediumArabinoseFinely tunable expressionLower maximum expression

The choice of expression system should balance plasmid copy number and promoter strength to maximize soluble recombinant protein expression and minimize metabolic burden . For frdC expression, research indicates that metabolic burden associated with transcription and translation of foreign genes can significantly impact protein expression levels and quality .

What are the optimal conditions for expressing recombinant frdC in E. coli?

Optimal expression of recombinant frdC requires careful consideration of several factors:

  • Strain selection: E. coli BL21(DE3) is commonly used for recombinant protein expression due to its deficiency in certain proteases. For frdC specifically, strains with reduced acetate production (such as BL21 ΔackA) may improve expression by limiting the accumulation of inhibitory metabolites .

  • Carbon source optimization: The choice between glucose and glycerol significantly impacts protein expression. Glycerol typically results in less acetate accumulation and may be preferable for frdC expression .

  • Expression vector design:

    • Balance between plasmid copy number and promoter strength

    • Properly oriented fumarate reductase subunits

    • All frdABCD genes should be expressed from the same plasmid rather than separated on different vectors, as separation affects functional assembly

  • Induction parameters:

    • Temperature (typically lowered to 18°C during induction)

    • IPTG concentration (usually 0.3 mM)

    • Induction timing (typically at OD600 of ~0.8)

    • Duration (typically 18 hours)

  • Growth conditions: Anaerobic cultivation may enhance expression of functional frdC, as this mimics the native conditions under which the frd operon is expressed .

How can I assay fumarate reductase activity in recombinant E. coli strains?

Multiple complementary assays can be used to evaluate fumarate reductase activity:

  • NADH-dependent assay: Measure the decrease in NADH absorbance at 340 nm (extinction coefficient: 6.2 mM⁻¹ cm⁻¹) in a reaction mixture containing 50 mM NaPO₄ buffer (pH 6.5), 20 mM fumarate, 0.2 mM NADH, and enzyme solution. Preincubate for 5 minutes at optimal temperature (e.g., 70°C for thermophilic enzymes) under anaerobic conditions before initiating the reaction by adding NADH and enzyme .

  • Methyl viologen-dependent assay: Monitor oxidation of reduced methyl viologen (MV+) to MV²+ at 600 nm when fumarate is reduced to succinate. This assay is particularly useful for evaluating the electron transfer capability of the enzyme .

  • Succinate production assay: Directly quantify succinate production by ion-exclusion chromatography (e.g., using a TSK-gel OApak-A column) measuring absorbance at 210 nm .

  • Reverse reaction (SDH activity): Measure succinate dehydrogenase activity using triphenyltetrazolium chloride and phenazine methosulfate, monitoring fumarate production by chromatography .

  • Benzyl viologen oxidase assay: This assay specifically evaluates the activity of the FRD A and FRD B dimer, which is active in this assay even in the absence of the membrane-anchoring subunits FRD C and FRD D .

What purification strategies work best for recombinant frdC from E. coli?

Effective purification of recombinant frdC requires consideration of its membrane-associated nature and integration within the fumarate reductase complex:

  • Affinity tags: Incorporation of N-terminal histidine (His) or maltose-binding protein (MBP) tags facilitates purification through affinity chromatography . The tag choice depends on downstream applications - His tags are smaller but MBP can enhance solubility.

  • Membrane protein solubilization: Since frdC is a membrane-anchoring subunit, solubilization with appropriate detergents (e.g., Triton X-100) is essential . The detergent concentration must be optimized to extract the protein from membranes while maintaining enzymatic activity.

  • Anaerobic purification: Perform all purification steps under anaerobic conditions to maintain the integrity of iron-sulfur clusters and prevent oxidative damage .

  • Iron-sulfur cluster reconstitution: For isolated frdC containing iron-sulfur clusters, an anaerobic reconstitution step may be necessary to restore full activity .

  • Functional complex purification: Since individual subunits may not properly fold or function in isolation, co-expression and co-purification of all four fumarate reductase subunits (frdABCD) is often necessary to obtain a functional complex .

How do mutations in frdC affect the assembly and function of the fumarate reductase complex?

Mutagenesis studies have revealed critical insights into structure-function relationships within the fumarate reductase complex:

MutationEffect on GrowthEffect on Enzyme ActivityMechanistic Insight
Wild typeGrowth with formate + fumarateFull activity in DMNH₂ → fumarateFunctional complex assembly
FrdC-E66QNo growth with formate + fumarateNo activity in DMNH₂ → fumarateEssential residue at menaquinol oxidation site
FrdC-E180QNo growth with formate + fumarate~10% activity in DMNH₂ → fumarate (solubilized)Altered heme b oxidation-reduction potentials
FrdC-E180INo growth with formate + fumarate~10% activity in DMNH₂ → fumarate (solubilized)Altered heme b oxidation-reduction potentials

These findings demonstrate that specific glutamate residues in frdC play critical roles in electron transfer and enzyme function . Notably:

  • When FrdC-E180 was mutated to glutamine or isoleucine, the enzyme retained succinate oxidation capability but lost the ability to grow anaerobically on fumarate, indicating a specific disruption of the quinol oxidation and electron transfer pathway .

  • The isolated Glu-C180 variants showed approximately 1/10 of the wild-type activity in the DMNH₂ → fumarate assay, but only after solubilization with Triton X-100, suggesting that membrane integration is affected by these mutations .

  • Mutations in frdC significantly altered the oxidation-reduction midpoint potentials of the heme groups, with heme bP showing a positive shift of approximately +48-49 mV in the E180Q and E180I variants compared to wild type .

These results highlight the essential role of frdC in electron transfer from quinols to the catalytic site and demonstrate how specific residues contribute to the proper functioning of the respiratory complex.

What mechanisms govern the electron transfer in the fumarate reductase complex?

Electron transfer in the fumarate reductase complex involves a sophisticated pathway that includes multiple cofactors:

  • Quinol binding and oxidation: The membrane-bound subunits FrdC and FrdD contain binding sites for menaquinol, the physiological electron donor. FrdC contains a conserved Glu-C66 residue that is essential for menaquinol oxidation .

  • Heme-mediated electron transport: FrdC contains two b-type hemes (bP and bD) with distinct midpoint potentials that facilitate electron transfer from quinol to the catalytic site. The redox potentials of these hemes are critical for directional electron flow, with heme bP having a higher potential (-10 mV) than heme bD (-149 mV) in wild-type enzyme .

  • Iron-sulfur cluster relay: Electrons are transferred from the hemes to a series of iron-sulfur clusters in FrdB, which ultimately deliver electrons to the catalytic site in FrdA .

  • Proton coupling: The reduction of fumarate to succinate is coupled to proton transfer, as evidenced by the significant solvent isotope effect (k(¹H₂O)obs/k(²H₂O)obs = 3.3) observed in wild-type enzyme but reduced (1.1) in mutant forms .

  • Alternative electron donors: While menaquinol is the physiological electron donor, studies have shown that artificial electron donors such as benzyl viologen can donate electrons directly to the FrdA,B dimer, bypassing the membrane-anchoring subunits FrdC and FrdD .

The importance of proper subunit assembly is highlighted by the observation that expression of frdABC and frdD from separate plasmids fails to restore anaerobic growth on fumarate, demonstrating that the physical continuity of the genes affects proper assembly and function of the complex .

How can I design experiments to investigate the contradictory data in frdC research?

When confronted with contradictory data in frdC research, a structured approach to experimental design and data analysis is essential:

  • Parameter classification: Apply a formal contradiction pattern notation using parameters (α, β, θ), where α represents the number of interdependent items, β represents the number of contradictory dependencies, and θ represents the minimal number of Boolean rules required to assess these contradictions .

  • Experimental validation through multiple methodologies:

    • Compare membrane-bound versus solubilized enzyme activity to identify context-dependent effects

    • Utilize different electron donors (NADH, methyl viologen, benzyl viologen) to identify pathway-specific defects

    • Measure both forward (fumarate reduction) and reverse (succinate oxidation) reactions to isolate directional constraints

  • Structured mutation analysis: Design a matrix of mutations targeting:

    • Conserved residues across different bacterial species

    • Different functional domains (quinol binding, heme coordination, membrane anchoring)

    • Residues with varying degrees of conservation

  • Comprehensive phenotypic characterization:

ParameterWild TypeMutant 1Mutant 2Interpretation
Growth on fumarate+--Essential function
Growth on nitrate+++Pathway-specific effect
Enzyme assemblyCompletePartialAbsentStructure formation impact
Membrane associationStrongWeakAbsentMembrane integration role
Electron transfer rateNormalReducedBlockedElectron pathway involvement
Heme incorporationCompletePartialAbsentCofactor binding function
  • Contradiction resolution strategies:

    • Identify strain-specific effects by testing multiple E. coli backgrounds

    • Evaluate temperature dependence to detect conditional phenotypes

    • Assess the impact of different carbon sources and growth conditions

    • Systematically vary the expression levels of each subunit to identify bottlenecks in complex assembly

  • Cross-validation with orthogonal techniques: Combine biochemical assays, structural studies, and in vivo phenotyping to build a coherent model that accounts for apparent contradictions .

Remember that contradictory data often reveals hidden complexities in biological systems rather than experimental errors, and may point to context-dependent functions or regulatory mechanisms that provide new insights into frdC biology.

How should I optimize the cloning strategy for recombinant frdC expression?

Successful cloning and expression of recombinant frdC requires careful consideration of several factors:

  • Vector selection:

    • Use vectors with compatible origins of replication if multiple plasmids are needed

    • Consider copy number effects: high copy number (pMB1' origin) vectors may increase yield but also increase metabolic burden

    • Low copy number vectors (p15A origin) may be preferable for toxic proteins or those requiring careful stoichiometry

  • Promoter optimization:

    • For high-level expression, T7 promoter systems in DE3 strains are effective

    • When expressing multiple frd subunits, consider using a single polycistronic construct under one promoter to maintain proper stoichiometry

    • Opposing promoters can cause transcriptional interference, affecting expression levels

  • Codon optimization:

    • Analyze the codon usage of frdC and optimize for E. coli expression if necessary

    • Pay particular attention to rare codons that may cause translational pausing

  • One-step cloning approach:

    • Consider using positive selection vectors with screening capabilities (like GFP-based systems) to simplify identification of correct clones

    • Design primers carefully to ensure in-frame fusion with any tags while maintaining important functional domains

  • Expression validation:

    • Use colony PCR to verify correct insertion orientation

    • Quantitative PCR can be used to determine plasmid copy number if yield issues arise

    • Western blotting with subunit-specific antibodies confirms expression of all components

It's important to note that for functional fumarate reductase, all four subunits must be expressed in the correct stoichiometry. Research has shown that separating the genes for FrdC and FrdD on different plasmids prevents proper assembly into a functional complex , suggesting that a single plasmid expressing all four subunits is optimal.

What E. coli strains are most suitable for recombinant frdC expression?

Different E. coli strains offer various advantages for recombinant frdC expression, depending on the specific research goals:

When selecting a strain for frdC expression, consider these factors:

  • Functional studies: For studies focusing on enzyme function rather than high-level expression, use E. coli strains lacking the native frd operon (like MI1443) to avoid background activity .

  • Membrane protein expression: Since frdC is a membrane protein, specialized strains like C41/C43 that are adapted for membrane protein expression may improve yields and proper membrane integration.

  • Expression optimization: For strains with the T7 expression system, co-transformation with chaperone-encoding plasmids (like pTf16) can enhance proper folding .

  • Metabolic considerations: Expression of functional frdC depends on proper cofactor incorporation (hemes, iron-sulfur clusters). Strains with robust cofactor synthesis or those with reduced acetate production (like BL21 ΔackA) may improve functional protein yield .

How can I troubleshoot low expression or activity of recombinant frdC?

When encountering problems with recombinant frdC expression or activity, a systematic troubleshooting approach is recommended:

  • Expression-level troubleshooting:

    • Verify transcription using RT-PCR or Northern blotting

    • Check translation using Western blotting with anti-His tag or subunit-specific antibodies

    • Examine soluble versus insoluble fractions to detect potential inclusion body formation

    • Analyze protein stability by performing time-course experiments post-induction

  • Functional complex assembly issues:

    • Ensure all four subunits (frdABCD) are expressed from the same plasmid for proper complex formation

    • Verify proper membrane association of FrdC and FrdD subunits through fractionation experiments

    • Consider co-expression with specific chaperones to aid proper folding

  • Cofactor incorporation problems:

    • For recombinant frdC with iron-sulfur clusters, measure iron and sulfur content (ideally 12.8 Fe and 6.9 S per monomer after reconstitution)

    • Check for proper heme incorporation by UV-Vis spectroscopy for typical [4Fe-4S] cluster-containing protein spectra

    • If activity is low, test whether addition of FMN to assay mixtures increases activity

    • Consider anaerobic reconstitution of iron-sulfur clusters if purified protein shows low activity

  • Activity assay optimization:

    • When assaying membrane-bound enzyme, activity may be undetectable but become measurable after solubilization with detergents

    • Try multiple electron donors (NADH, NADPH, reduced methyl viologen, reduced benzyl viologen)

    • Ensure anaerobic conditions during activity assays, as oxygen can oxidize the reduced electron donors and inhibit activity

    • Optimize buffer conditions, especially pH (typically 6.5) and salt concentration

  • Expression conditions adjustment:

    • Lower the induction temperature (e.g., to 18°C) to slow protein synthesis and improve folding

    • Reduce IPTG concentration to decrease expression rate and metabolic burden

    • Test different carbon sources (glucose versus glycerol) as they can significantly impact protein expression levels

    • Consider co-expression of all frd subunits with the pTf16 plasmid encoding the TF chaperone to enhance proper folding

What are the emerging techniques for studying frdC structure and function?

Several cutting-edge approaches are advancing our understanding of frdC:

  • Cryo-electron microscopy (cryo-EM): This technique enables visualization of the fumarate reductase complex in its native membrane environment, providing insights into the spatial arrangement of all four subunits and their interaction with membrane lipids and quinones.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This method can map dynamic regions and conformational changes in frdC during electron transfer, providing insights into how structural changes couple to enzymatic function.

  • Time-resolved spectroscopy: Ultra-fast spectroscopic techniques can track electron transfer through the various cofactors of the fumarate reductase complex, revealing the kinetics and energetics of each step in the electron transfer pathway.

  • Nanodiscs technology: Reconstitution of the fumarate reductase complex in nanodiscs provides a defined membrane environment for functional and structural studies, allowing better control over lipid composition and protein density.

  • CRISPR-Cas9 genome editing: This approach enables precise modification of the chromosomal frd operon, allowing study of fumarate reductase variants in their native genetic context without plasmid-based overexpression.

  • In vivo electron transfer imaging: Development of redox-sensitive fluorescent probes that can monitor electron flow through respiratory chains in living bacteria is opening new avenues for understanding how frdC functions within the cellular context.

How can research on E. coli frdC inform studies of fumarate reductases in other organisms?

The E. coli fumarate reductase system serves as an important model for understanding similar systems across biological domains:

  • Comparative genomics approaches: Alignment of frdC sequences across diverse bacteria reveals conserved functional residues versus lineage-specific adaptations, informing structure-function relationships.

  • Evolutionary adaptations: Studying how frdC has evolved different electron transfer mechanisms in organisms from various ecological niches provides insights into redox chemistry adaptation.

  • Pathogen-specific applications: Many pathogenic bacteria rely on fumarate reductase for survival in low-oxygen environments encountered during infection. Understanding differences between E. coli frdC and pathogen-specific variants may reveal selective inhibition strategies.

  • Bioenergetic diversity: Comparing the energetics and regulation of E. coli fumarate reductase with homologous systems in extremophiles, anaerobes, and facultative organisms reveals how electron transport chains adapt to different environmental constraints.

  • Biochemical engineering applications: Knowledge of structure-function relationships in E. coli frdC can inform protein engineering efforts to create modified respiratory complexes with novel substrate specificities or improved catalytic efficiencies for biotechnological applications.

  • Mitochondrial disease models: As a prokaryotic ancestor of mitochondrial respiratory complexes, insights from E. coli frdC can inform understanding of mutations affecting homologous complexes in mitochondrial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.