Recombinant Escherichia coli O9:H4 Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdD; EcHS_A4395; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGIVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is utilized during anaerobic growth, while succinate dehydrogenase is used in aerobic growth. FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Fumarate reductase subunit D (frdD) in E. coli O9:H4?

Fumarate reductase subunit D (frdD) is one of the four essential subunits (FrdA, FrdB, FrdC, and FrdD) of the fumarate reductase enzyme complex in Escherichia coli. This enzyme catalyzes the reduction of fumarate to succinate during anaerobic respiration, enabling bacterial growth in oxygen-limited environments. The frdABCD operon encodes the complete enzyme complex, and all four subunits are required for functional assembly .

Experimental evidence demonstrates that FrdD, along with FrdC, serves two critical functions:

  • Anchoring the catalytic FrdAB dimer to the cytoplasmic membrane

  • Enabling interaction with quinones in the electron transport chain

In complementation studies with E. coli strain MI1443 (which lacks a chromosomal frd operon), introduction of all four fumarate reductase subunits was essential for restoring anaerobic growth on glycerol and fumarate. Neither subunit alone was sufficient for enzyme activity .

How is the frdABCD operon regulated in E. coli?

The frdABCD operon in E. coli is regulated by multiple sophisticated mechanisms:

  • C4-dicarboxylate regulation: Expression is transcriptionally regulated by C4-dicarboxylates through the DcuSR two-component regulatory system. This system consists of:

    • DcuS: a sensory histidine kinase that detects C4-dicarboxylates

    • DcuR: a response regulator that affects transcription

  • Environmental sensing: The DcuSR system responds to extracellular C4-dicarboxylates including fumarate, succinate, malate, aspartate, tartrate, and maleate .

  • Genetic control: Inactivation of either dcuR or dcuS genes causes loss of C4-dicarboxylate-stimulated synthesis of fumarate reductase and related proteins .

Data from experimental studies show that in wild-type E. coli, the expression of frdA (and by extension the frdABCD operon) is stimulated approximately 2-fold in the presence of fumarate :

ConditionRelative Expression Level of frdA
Without fumarate1.0 (baseline)
With fumarate~2.0 (2-fold increase)

Additionally, a study identified the frdR gene which globally regulates several operons involved in anaerobic growth response to nitrate, further demonstrating the complex regulatory network controlling frdABCD expression .

What is the relationship between fumarate reductase and anaerobic respiration in E. coli?

Fumarate reductase plays a central role in the anaerobic respiratory chain of E. coli, functioning as a terminal reductase that allows the bacterium to use fumarate as an alternative electron acceptor when oxygen is unavailable:

  • Respiratory flexibility: E. coli possesses diverse respiratory abilities, with at least five terminal oxidoreductases for anaerobic respiration with alternative electron acceptors: nitrate, dimethyl sulfoxide (DMSO), trimethylamine-N-oxide (TMAO), and fumarate .

  • Energy generation: The fumarate reductase enzyme couples oxidation of NADH to various electron donors via the cellular quinone pool (ubiquinone or menaquinone) .

  • Metabolic pathway: Fumarate reduction to succinate is physiologically opposite to the reaction catalyzed by succinate dehydrogenase during aerobic metabolism .

  • Growth requirement: Experimental evidence confirms that functional fumarate reductase is essential for anaerobic growth on glycerol with fumarate as the terminal electron acceptor .

This respiratory flexibility represents an evolutionary adaptation that allows E. coli to thrive in diverse environments with varying oxygen availability.

What methodologies are most effective for expressing recombinant frdD in heterologous systems?

Expressing functional recombinant frdD presents several challenges due to its membrane-associated nature. Based on existing research, the following methodological approaches are recommended:

  • Coexpression strategy: Expression of frdD together with other fumarate reductase subunits is crucial. Research demonstrates that "separation of the DNA coding for the FRD C and FRD D proteins affected the ability of fumarate reductase to assemble into a functional complex" . Consider using polycistronic expression vectors that maintain the natural gene arrangement.

  • Factorial design approach: Implement a 2^n factorial design to optimize expression conditions, evaluating key variables:

VariableLower LevelHigher Level
Temperature25°C37°C
IPTG concentration0.1 mM1.0 mM
Induction time4 hoursOvernight
Medium compositionMinimalRich
AerationLowHigh
pH6.57.5

This approach allows systematic identification of optimal conditions with fewer experiments through statistical analysis of variable interactions .

  • Membrane fraction isolation: Since FrdD is membrane-associated, isolate membrane fractions after cell disruption through differential centrifugation to assess proper membrane incorporation.

  • Functionality assessment: Verify functional assembly through:

    • Benzyl viologen oxidase assay (for FrdAB activity)

    • Oxidation of reduced quinone analogues (requires both FrdC and FrdD)

    • Complementation tests in frd-deficient strains

  • Protein solubilization: For purification purposes, mild detergents like n-dodecyl-β-D-maltoside may be effective for extracting membrane-bound fumarate reductase while maintaining protein-protein interactions.

How can site-directed mutagenesis be used to study structure-function relationships in frdD?

Site-directed mutagenesis provides powerful tools for investigating structure-function relationships in frdD:

  • Membrane association domains: Create targeted mutations in hydrophobic regions to identify amino acid residues critical for membrane anchoring. Mutations disrupting membrane association would prevent proper localization of the fumarate reductase complex.

  • Protein-protein interaction sites: Systematically mutate residues at potential interfaces with FrdC to identify interaction domains. Research shows that FrdD must interact properly with FrdC for functional assembly .

  • Quinone binding regions: Generate mutations in conserved residues potentially involved in quinone interaction, as both FrdC and FrdD are required for the oxidation of reduced quinone analogues .

  • Experimental approach:

    • Create a library of frdD mutants using PCR-based mutagenesis

    • Express mutants in an frdD-deficient strain

    • Assess membrane association through subcellular fractionation

    • Measure fumarate reductase activity using established assays

    • Determine protein-protein interactions via crosslinking or co-immunoprecipitation

  • Complementation testing: Evaluate each mutant's ability to restore anaerobic growth on glycerol and fumarate in an frdD-deficient strain, providing a functional readout of mutation effects.

This systematic mutagenesis approach would generate a comprehensive map of structure-function relationships in frdD, revealing domains essential for membrane association, protein interactions, and electron transfer.

How does the interaction between frdD and other fumarate reductase subunits affect enzyme assembly and function?

The interaction between frdD and other fumarate reductase subunits is crucial for proper enzyme assembly and function, as evidenced by multiple experimental approaches:

  • Subunit requirements: Research demonstrates that all four subunits (FrdA, FrdB, FrdC, and FrdD) must be present and properly arranged for functional enzyme assembly. The FrdA-FrdB dimer forms the catalytic core, while FrdC and FrdD anchor this dimer to the membrane .

  • Spatial organization: Experimental evidence shows that "Introduction into E. coli MI1443 of the frdABC and frdD genes on two separate plasmid vectors failed to restore anaerobic growth on glycerol and fumarate" . This indicates that the physical proximity of genes encoding FrdC and FrdD is critical for proper assembly.

  • Functional domains:

    • FrdA, FrdB: Constitute the catalytic dimer with activity in the benzyl viologen oxidase assay

    • FrdC, FrdD: Required for membrane association and electron transfer from quinones

  • Assembly mechanism: The following model explains the sequential assembly process:

Assembly StageComponentsFunction
Stage 1FrdA + FrdBFormation of catalytic dimer
Stage 2FrdA-FrdB + FrdC-FrdDMembrane anchoring
Stage 3Complete complexElectron transfer from quinones to fumarate

Disrupting any of these interactions through genetic manipulation prevents proper assembly and function of the fumarate reductase complex, highlighting the interdependence of all four subunits .

What is the role of frdD in E. coli respiratory adaptation to oxygen-limited environments?

FrdD plays a critical role in E. coli's respiratory adaptation to oxygen-limited environments through several mechanisms:

  • Respiratory chain diversification: As part of the fumarate reductase complex, frdD enables E. coli to use fumarate as an alternative terminal electron acceptor when oxygen is unavailable. This diversification is crucial for bacterial survival in anoxic environments .

  • Regulatory network integration: The frdABCD operon is part of a complex regulatory network that controls electron flow in E. coli. This network includes:

    • The FNR global regulator that senses oxygen availability

    • The DcuSR two-component system that detects C4-dicarboxylates

    • The FrdR regulator that coordinates expression of anaerobic respiratory genes

  • Metabolic adaptation: By enabling fumarate respiration, frdD contributes to the bacterium's ability to switch between different metabolic modes based on environmental conditions:

ConditionDominant EnzymeReaction DirectionGene Expression
AerobicSuccinate dehydrogenase (sdh)Succinate → FumarateHigh sdh, Low frd
Anaerobic with fumarateFumarate reductase (frd)Fumarate → SuccinateLow sdh, High frd
  • Energy efficiency: Fumarate respiration, enabled by the fumarate reductase complex containing frdD, provides higher energy yields than fermentation, giving E. coli a competitive advantage in oxygen-limited environments where alternative electron acceptors are available .

This respiratory flexibility represents a sophisticated adaptation that allows E. coli to thrive in diverse environments, including the oxygen-limited conditions often encountered in the human gut.

How does the genetic sequence of frdD in E. coli O9:H4 compare to other E. coli strains and what are the functional implications?

Comparative genomic analysis of frdD across E. coli strains reveals both conservation and strain-specific variations with important functional implications:

  • Sequence conservation: The core functional domains of frdD are generally conserved across E. coli strains, reflecting the essential role of fumarate reductase in anaerobic respiration. This conservation suggests strong evolutionary pressure to maintain functional fumarate reductase.

  • Serotype-specific variations: While the search results don't provide specific sequence data for frdD in E. coli O9:H4, studies of related genes in O9 serotypes suggest potential strain-specific adaptations. E. coli O9 strains demonstrate genetic diversity in other membrane-associated components, such as the O-antigen biosynthesis genes .

  • Genomic context variations: The genomic organization surrounding the frd operon may vary between strains, potentially affecting gene expression and regulation. This is relevant given the importance of the physical proximity of frdC and frdD genes for proper protein assembly .

  • Methodological approach for sequence analysis:

    • Obtain frdD sequences from multiple E. coli strains, including O9:H4

    • Perform multiple sequence alignment

    • Calculate percent identity and identify variable regions

    • Correlate variations with membrane interaction domains, FrdC interaction sites, or quinone binding regions

    • Test functional implications through complementation studies

  • Functional implications: Strain-specific variations in frdD may contribute to differences in:

    • Enzyme kinetics and efficiency

    • Temperature adaptation

    • Substrate specificity

    • Membrane association properties

    • Interaction with strain-specific variants of other Frd subunits

Understanding these genetic variations would provide insight into strain-specific adaptations of the anaerobic respiratory machinery across diverse E. coli lineages.

What are the most effective purification strategies for obtaining functional recombinant frdD?

Purifying functional recombinant frdD presents unique challenges due to its membrane association and dependence on interactions with other subunits. The following purification strategy integrates multiple approaches to maintain structural integrity and function:

  • Co-expression and co-purification: Express the complete frdABCD operon to ensure proper assembly. Research indicates that "Introduction of all four fumarate reductase subunits into E. coli MI1443 was essential for the restoration of growth" .

  • Membrane isolation:

    • Disrupt cells by sonication or French press

    • Remove unbroken cells and debris (2,000-5,000 × g centrifugation)

    • Isolate membrane fraction (100,000 × g ultracentrifugation)

    • Assess fumarate reductase activity in membrane fractions

  • Solubilization optimization: Test multiple detergents at various concentrations:

DetergentWorking RangeAdvantages
n-Dodecyl-β-D-maltoside (DDM)0.5-2%Mild, maintains protein-protein interactions
Digitonin0.5-1%Very mild, preserves native state
Triton X-1000.5-1%Cost-effective, efficient
Lauryl maltose neopentyl glycol (LMNG)0.01-0.1%Low CMC, stable micelles
  • Affinity purification: Add a small affinity tag (e.g., His6) to frdD or another subunit of the complex, ensuring the tag doesn't interfere with membrane association or complex formation.

  • Size exclusion chromatography: Perform as a final polishing step to ensure isolation of intact fumarate reductase complexes and removal of aggregates.

  • Functional verification: Confirm activity at each purification step using:

    • Fumarate reduction assay with artificial electron donors

    • Quinone oxidation assay

    • Assessment of subunit composition by SDS-PAGE

  • Stability enhancement: Include glycerol (10-20%) and reducing agents in all buffers to maintain protein stability throughout purification.

This integrated strategy maximizes the likelihood of obtaining functional recombinant frdD within its native complex, suitable for structural and functional studies.

How can researchers troubleshoot expression problems with recombinant frdD?

Troubleshooting recombinant frdD expression requires a systematic approach to identify and address potential issues:

  • Expression level assessment:

    • Verify transcription using RT-PCR

    • Detect protein expression via Western blot with anti-frdD antibodies

    • Check for inclusion body formation with solubility fractionation

  • Common issues and solutions:

ProblemPossible CausesSolutions
Low expressionCodon bias, toxicityUse codon-optimized sequence, tune expression level
Insoluble proteinImproper folding, lack of chaperonesLower temperature (16-25°C), co-express chaperones
DegradationProtease activityAdd protease inhibitors, use protease-deficient strains
Lack of membrane associationMissing interacting partnersCo-express with frdC and other subunits
Functional assembly failureImproper subunit ratiosUse polycistronic vectors maintaining native gene arrangement
  • Optimization using statistical design: Implement a factorial design approach to systematically evaluate multiple variables simultaneously, as demonstrated for other recombinant proteins :

    • Define key variables (temperature, inducer concentration, media composition)

    • Create a factorial design matrix

    • Analyze results statistically to identify significant factors and interactions

  • Strain selection: Test multiple expression strains:

    • BL21(DE3): Standard expression strain

    • C41/C43(DE3): Specialized for membrane proteins

    • Rosetta: Provides rare codons

    • Lemo21(DE3): Tunable expression level

  • Fusion tag strategies: Test different fusion partners to enhance solubility while maintaining function:

    • SUMO: Enhances solubility, removable

    • MBP: Highly soluble, affinity purification

    • TrxA: Promotes proper disulfide bond formation

  • Media optimization: Implement supplementation strategies to enhance membrane protein expression:

    • Add glycerol (0.5-2%) to stabilize membranes

    • Include specific phospholipids to aid membrane protein folding

    • Test minimal vs. rich media for optimal membrane protein insertion

This comprehensive troubleshooting approach addresses the complex challenges associated with recombinant frdD expression, increasing the likelihood of obtaining functional protein for downstream applications.

What are the critical residues in frdD for membrane anchoring and quinone interaction?

While detailed structural data specific to frdD from E. coli O9:H4 is limited in the search results, analysis of functional studies and related membrane proteins reveals several critical features:

  • Transmembrane domains: As a membrane anchor protein, frdD likely contains multiple transmembrane helices that span the cytoplasmic membrane. These hydrophobic regions are essential for membrane insertion and stability of the fumarate reductase complex.

  • FrdC interaction interface: Experimental evidence demonstrates that both FrdC and FrdD are required together for membrane association of fumarate reductase . This suggests specific interaction domains between these proteins that facilitate proper assembly.

  • Quinone interaction sites: Both FrdC and FrdD are required for the oxidation of reduced quinone analogues , indicating that frdD contains residues involved in quinone binding or creating the appropriate environment for quinone interaction.

  • Proposed key regions based on functional studies:

Region TypePredicted RoleExperimental Evidence
Transmembrane helicesMembrane anchoringRequired for membrane association
FrdC-interacting domainsComplex assemblySeparation of frdC and frdD genes prevents functional assembly
Quinone-binding residuesElectron transferBoth FrdC and FrdD required for quinone oxidation
  • Methodological approach to identify critical residues:

    • Perform alanine-scanning mutagenesis of conserved residues

    • Assess membrane association through subcellular fractionation

    • Measure quinone oxidation activity with each mutant

    • Evaluate protein-protein interactions via crosslinking studies

Identifying these critical residues would provide valuable insights into the molecular mechanism of fumarate reductase membrane anchoring and electron transfer from quinones to the catalytic site.

How does the anaerobic respiratory system in E. coli O9:H4 compare with other pathogenic E. coli strains?

The anaerobic respiratory system in E. coli O9:H4 shares core components with other E. coli strains while potentially exhibiting strain-specific adaptations:

  • Core respiratory components: All E. coli strains, including O9:H4, possess the fundamental components of anaerobic respiration:

    • Fumarate reductase (frdABCD)

    • Nitrate reductase systems

    • DMSO/TMAO reductases

    • Regulatory systems (FNR, DcuSR)

  • Strain-specific variations:

    • While the search results don't provide specific comparisons between O9:H4 and other pathogenic strains, studies of E. coli O104:H4 (a highly pathogenic strain) demonstrate that even closely related strains can exhibit significant differences in gene content and regulation .

    • Research on O9 strains indicates genetic diversity in membrane-associated components , suggesting potential variations in respiratory chain components.

  • Comparative analysis approach:

    • Genomic comparison of respiratory gene clusters

    • Expression pattern analysis under anaerobic conditions

    • Functional assessment of respiratory capabilities

    • Evolutionary analysis of respiratory gene acquisition/adaptation

  • Pathogenicity correlations: Anaerobic respiration capabilities may contribute to pathogenic potential by enabling survival in oxygen-limited host environments:

Respiratory CapabilityPotential Contribution to Pathogenicity
Fumarate respirationSurvival in intestinal environment
Nitrate respirationAdaptation to inflammatory conditions
Regulatory flexibilityRapid adaptation to changing host environments
  • Evolutionary implications: The diversity in anaerobic respiratory systems may reflect adaptation to specific ecological niches:

    • Commensal strains: Adapted to the intestinal environment

    • Extraintestinal pathogenic strains: Adapted to diverse host tissues

    • Food-borne pathogens: Adapted to survive food processing conditions

Understanding these strain-specific adaptations in anaerobic respiration could provide insights into the ecological versatility and pathogenic potential of different E. coli lineages, including O9:H4.

How can understanding frdD function contribute to antimicrobial development against pathogenic E. coli?

Understanding frdD function presents several strategic opportunities for antimicrobial development against pathogenic E. coli:

  • Targeting anaerobic survival: Fumarate reductase is essential for anaerobic growth when fumarate is the terminal electron acceptor . Inhibitors of this enzyme would specifically target bacteria in oxygen-limited environments, such as the intestinal tract or abscesses.

  • Structural-based drug design: Detailed knowledge of frdD structure and its interactions with other subunits enables rational design of:

    • Small molecules disrupting FrdC-FrdD interactions

    • Compounds preventing proper membrane association

    • Agents blocking quinone binding sites

  • Selective toxicity advantages: Fumarate reductase in bacteria differs significantly from mammalian succinate dehydrogenase, despite catalyzing related reactions. These differences provide opportunities for selective targeting:

FeatureBacterial Fumarate ReductaseMammalian Succinate Dehydrogenase
Subunit compositionFrdA, FrdB, FrdC, FrdDSDHA, SDHB, SDHC, SDHD
Reaction directionFumarate → SuccinateSuccinate → Fumarate
Cofactor requirementsMenaquinoneUbiquinone
Membrane organizationBacterial-specific anchoringMitochondrial inner membrane
  • Combination therapy strategies: Fumarate reductase inhibitors could be particularly effective when combined with:

    • Traditional antibiotics targeting aerobic metabolism

    • Compounds disrupting biofilm formation

    • Agents that increase oxygen tension in infected tissues

  • Bioavailability considerations: Since frdD is membrane-associated, effective inhibitors would need appropriate physicochemical properties to:

    • Penetrate bacterial outer membrane

    • Access the cytoplasmic membrane

    • Interact with the membrane-embedded portions of frdD

  • Resistance development assessment: Evaluate potential resistance mechanisms:

    • Mutations in frdD altering inhibitor binding

    • Upregulation of alternative anaerobic respiratory pathways

    • Modifications to membrane composition affecting drug access

This multi-faceted approach to antimicrobial development based on frdD function could yield novel therapeutics effective against pathogenic E. coli strains in oxygen-limited environments where many conventional antibiotics show reduced efficacy.

What are the implications of frdD research for understanding bacterial adaptation to environmental stress?

Research on frdD provides significant insights into bacterial adaptation to environmental stress, particularly oxygen limitation:

  • Respiratory flexibility: Fumarate reductase, containing frdD, represents a key component of E. coli's respiratory flexibility. This adaptability allows bacteria to:

    • Rapidly switch between aerobic and anaerobic metabolism

    • Utilize diverse electron acceptors based on availability

    • Maintain energy production under varying environmental conditions

  • Regulatory network integration: The frdABCD operon integrates into a sophisticated regulatory network that senses and responds to multiple environmental signals:

    • Oxygen availability (via FNR)

    • Carbon source availability (via catabolite repression)

    • C4-dicarboxylate presence (via DcuSR)

    • Nitrate availability (via NarL/NarP)

  • Energy efficiency adaptation: During environmental stress, bacteria must optimize energy production. Fumarate respiration provides higher ATP yields than fermentation but lower than aerobic respiration, representing an intermediate strategy when oxygen is limited .

  • Evolutionary implications: The conservation of fumarate reductase across diverse bacterial species suggests its fundamental importance in adaptation to changing environments. Comparative genomic analysis of frdD across different E. coli strains could reveal:

    • Niche-specific adaptations

    • Evolutionary pressure on different functional domains

    • Horizontal gene transfer events

  • Biofilm relevance: Within biofilms, steep oxygen gradients exist, with anaerobic microenvironments in deeper layers. Fumarate reductase likely plays a crucial role in bacterial survival within these structured communities, where oxygen limitation is a significant stress factor.

  • Host-pathogen interactions: During infection, bacteria encounter various oxygen-limited environments within the host. The ability to use fumarate as an alternative electron acceptor may contribute to bacterial persistence:

Host EnvironmentOxygen StatusRespiratory Adaptation
Intestinal lumenAnaerobicFumarate/nitrate respiration
Mucosal surfaceMicroaerobicMixed respiratory strategies
AbscessesAnaerobicFermentation/anaerobic respiration
BloodstreamAerobicAerobic respiration

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.