Recombinant Escherichia coli O9:H4 Inner membrane protein CbrB (cbrB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant CbrB

Recombinant Escherichia coli O9:H4 Inner Membrane Protein CbrB (cbrB) is a laboratory-produced protein derived from the E. coli O9:H4 serotype. It is primarily used in life sciences research, particularly for studying bacterial membrane biology, protein interactions, and pathogenicity mechanisms. The protein is expressed in heterologous systems such as E. coli or Shigella species, with His-tagged versions available for purification .

3.1. Diagnostic and Detection Tools

CbrB is utilized in enzyme-linked immunosorbent assays (ELISAs) to detect antibodies or study immune responses. For example:

  • Product Specifications: ELISA kits for CbrB include 50 µg of recombinant protein per vial, optimized for antibody detection in serum or tissue samples .

  • Applications: Supports studies on E. coli pathogenesis, particularly in serotypes linked to diarrheagenic E. coli (DEC) or STEAEC hybrids .

3.2. Pathogenicity and Serotype Diversity

While E. coli O9 strains are often classified as commensal, some harbor DEC genes (e.g., aggR, aap) associated with enteropathogenicity . CbrB’s role in virulence is not explicitly documented, but its presence in pathogenic serotypes like O9:H4 suggests potential involvement in membrane stability or host interaction.

3.3. Biotechnological Production

Recombinant CbrB is produced via high-cell-density fermentation, with protocols optimized for soluble protein yield. Industrial-scale processes involve phosphate-limited conditions to induce protein expression, as observed in similar E. coli systems .

Table 1: Key Properties of Recombinant CbrB

PropertyValue
Molecular WeightNot explicitly reported (estimated based on AA sequence)
PurityHigh (His-tag purification)
Expression Region1–157 amino acids
Related PathwaysNot extensively characterized (limited pathway data available)

Table 2: Amino Acid Sequence Segments

SegmentSequence
N-TerminalMSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLLVIIQVLPLFLLLSITTGAIPALLTGVMVACLPEKIGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSE
C-TerminalLFENILSGDSLVVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS

Research Gaps and Future Directions

  • Functional Studies: Direct evidence linking CbrB to bacterial survival, virulence, or membrane transport is lacking.

  • Pathogenicity: Further investigation is needed to determine whether CbrB contributes to the pathogenic potential of E. coli O9:H4, particularly in hybrid STEAEC strains .

  • Interaction Mapping: Proteomic studies could identify binding partners or pathways involving CbrB .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we welcome specific format requests. Please indicate your preferred format when placing your order, and we will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary based on your purchase method and location. We recommend contacting your local distributors for specific delivery time estimates.
Note: All protein shipments are standardly sent with blue ice packs. If dry ice packaging is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we advise centrifuging the vial briefly before opening to gather the contents at the bottom. Reconstitute the protein using deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form offers a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
cbrB; EcHS_A3930; Inner membrane protein CbrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
cbrB
Target Protein Sequence
MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLLVIIQVLPLFLLLSITTGAIP ALLTGVMVACLPEKIGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGD SLVVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS
Uniprot No.

Target Background

Database Links
Protein Families
CbrB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of CbrB in E. coli and how does it function within the bacterial membrane?

CbrB functions as an inner membrane protein in E. coli that appears to be involved in envelope stress responses and potentially copper homeostasis, similar to other inner membrane proteins like YhiM. The protein likely plays a role in the bacterial adaptation to environmental stresses by interacting with stress response systems such as CpxAR.

To study CbrB's membrane localization and function, researchers typically employ a combination of:

  • Subcellular fractionation to confirm membrane localization

  • Fluorescent protein tagging to visualize localization in vivo

  • Membrane protein topology mapping using PhoA/LacZ fusion analysis

  • Site-directed mutagenesis to identify functional domains

When conducting these experiments, it's critical to maintain the native membrane environment or use appropriate membrane mimetics to preserve protein function .

What expression systems are most effective for producing recombinant CbrB protein?

Expression of inner membrane proteins like CbrB presents unique challenges due to their hydrophobic domains and potential toxicity when overexpressed. Based on current practices with similar membrane proteins, the following expression strategies are recommended:

  • Use of specialized E. coli strains designed for membrane protein expression (C41/C43, Lemo21)

  • Expression under the control of tightly regulated promoters (T7lac or arabinose-inducible)

  • Optimization of induction conditions (lower temperatures of 16-25°C, reduced inducer concentrations)

  • Addition of fusion tags that enhance solubility and membrane insertion

For higher yields, the HlyA secretion system may be considered, as it has successfully secreted various structurally different proteins in E. coli. This approach would require fusion to the nontoxic 50-60 amino acid HlyA C-terminal domain, which is essential for protein translocation .

How can researchers confirm the proper folding and functionality of recombinant CbrB?

Verifying proper folding and function of membrane proteins like CbrB requires multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Limited proteolysis to evaluate compact domain formation

  • Functional assays specific to the protein's known or predicted activity

  • Complementation assays in cbrB knockout strains to test for functional restoration

When evaluating functionality, it's important to consider the protein's native environment. For copper-responsive inner membrane proteins, testing should include copper challenge assays and quantitative PCR (qPCR) analysis of stress response genes like cpxP, which has been shown to be upregulated during copper stress in similar systems .

What purification strategies work best for CbrB while maintaining its structural integrity?

Purifying inner membrane proteins while preserving their native structure requires careful consideration of detergents and buffer conditions:

Purification StageRecommended ApproachKey Considerations
Membrane ExtractionMild detergents (DDM, LMNG, or C12E8)Concentration needs optimization to prevent protein denaturation
Affinity ChromatographyIMAC using His-tagInclude detergent above CMC in all buffers
Size ExclusionSuperdex 200 or similarAssess oligomeric state in different detergents
Stability AssessmentThermal shift assays with CPM dyeMonitor stability in various detergent/lipid combinations

It's crucial to include protease inhibitors throughout the purification process and maintain consistent temperature conditions (typically 4°C) to minimize protein degradation .

How does CbrB interact with the CpxAR envelope stress response system in E. coli, and what methodologies best capture this interaction?

The interaction between inner membrane proteins like CbrB and stress response systems such as CpxAR can be studied using sophisticated approaches that capture both physical interactions and functional relationships:

  • Bacterial two-hybrid assays specifically designed for membrane protein interactions

  • Co-immunoprecipitation with crosslinking to stabilize transient interactions

  • Förster resonance energy transfer (FRET) with fluorescently tagged proteins to detect interactions in living cells

  • Quantitative phosphoproteomics to track signaling cascades

Research on similar inner membrane proteins has shown that deletion mutants often exhibit significantly altered expression of stress response genes. For example, studies on YhiM demonstrated that a ΔyhiM mutant had significantly higher expression of cpxP than the wild-type strain under basal conditions, which further increased during copper stress .

To properly interpret these interactions, researchers should:

  • Perform gene expression analysis under various stress conditions

  • Correlate protein-protein interaction data with physiological responses

  • Use isogenic strains with specific mutations in key signaling components

  • Validate findings through complementation studies

What structural domains of CbrB are critical for its function, and how can they be experimentally determined?

Identifying the functional domains of membrane proteins like CbrB requires a multilayered approach combining computational prediction with experimental validation:

  • Initial domain prediction using bioinformatics tools (TMHMM, Phobius, TOPCONS)

  • Cysteine scanning mutagenesis to map topology and accessible regions

  • Hydrogen/deuterium exchange mass spectrometry to identify solvent-accessible regions

  • Cryo-electron microscopy for structural determination, particularly effective for membrane proteins

When analyzing results, it's important to correlate structural features with functional outcomes by generating a library of truncation and point mutants followed by functional assays. For inner membrane proteins involved in stress responses, researchers should assess:

  • Copper sensitivity in deletion mutants compared to wild-type strains

  • Expression levels of stress-responsive genes like cpxP under various conditions

  • Protein-protein interaction profiles with known components of stress response systems

Successful structure-function studies require careful control of experimental conditions to avoid artifacts from protein overexpression or improper membrane insertion .

How does CbrB expression correlate with bacterial resistance to environmental stresses, particularly copper stress?

The relationship between CbrB expression and stress resistance can be rigorously investigated through a combination of transcriptomic, proteomic, and phenotypic approaches:

  • RNA-Seq analysis under varying copper concentrations to establish expression patterns

  • Quantitative proteomics to correlate transcript levels with protein abundance

  • Phenotypic assays measuring growth curves under copper stress

  • Competition assays between wild-type and cbrB mutant strains

Based on research with similar inner membrane proteins, deletion mutants often show altered sensitivity to copper. For example, the ΔyhiM mutant exhibited increased resistance to copper compared to wild-type strains, indicating a complex relationship between inner membrane proteins and copper homeostasis .

When designing these experiments, researchers should:

  • Include appropriate controls for metal specificity (testing other metals besides copper)

  • Assess dose-dependent relationships

  • Consider temporal dynamics of gene expression and stress response

  • Account for potential compensatory mechanisms in deletion mutants

What are the most effective approaches for studying CbrB protein interactions within the bacterial membrane environment?

Studying protein interactions within the native membrane environment presents significant technical challenges that can be addressed through specialized approaches:

TechniqueApplicationAdvantagesLimitations
In vivo crosslinkingCaptures transient interactions in native environmentPreserves physiological contextMay produce false positives due to proximity
FRET/BRETReal-time interaction monitoringWorks in living cellsRequires protein tagging that may affect function
Proximity labeling (BioID, APEX2)Identifies proximal proteinsDoesn't require stable interactionsSpatial resolution limitations
Native mass spectrometryPreserves intact protein complexesCan determine stoichiometryTechnically challenging for membrane proteins

When interpreting interaction data, researchers should be aware that membrane protein interactions are often influenced by lipid composition and membrane potential. Therefore, validation in multiple systems and under various conditions is essential to establish biologically meaningful interactions .

How can researchers differentiate between direct and indirect effects when studying CbrB knockout/mutation phenotypes?

Distinguishing direct from indirect effects in CbrB functional studies requires a systematic approach:

  • Generate clean deletion mutants with minimal polar effects on adjacent genes

  • Create complementation strains expressing wild-type CbrB from plasmids or in trans

  • Develop point mutants that affect specific functions rather than the entire protein

  • Use inducible expression systems to control timing and level of expression

For data analysis, researchers should:

  • Compare transcriptomic and proteomic profiles between knockout, complemented, and wild-type strains

  • Apply network analysis to identify primary versus secondary effects

  • Perform time-course experiments to establish the sequence of cellular events

  • Consider epistasis analysis with related genes in the same pathway

Studies on similar inner membrane proteins have shown that deletion mutants often exhibit complex phenotypes that reflect both direct effects and compensatory responses. For example, the increased resistance to copper in a ΔyhiM mutant was linked to activation of the CpxAR envelope stress response system, demonstrating the interconnected nature of these response pathways .

What are the most common pitfalls when working with recombinant CbrB and how can they be avoided?

Working with recombinant inner membrane proteins like CbrB presents several challenges that researchers should anticipate and address:

  • Low expression levels

    • Optimize codon usage for E. coli

    • Test multiple expression strains and conditions

    • Consider specialized vectors designed for membrane proteins

  • Protein misfolding

    • Express at lower temperatures (16-20°C)

    • Include membrane-mimetic environments during purification

    • Test fusion partners that enhance folding (MBP, SUMO)

  • Aggregation during purification

    • Screen multiple detergents at various concentrations

    • Include lipids in purification buffers

    • Consider amphipols or nanodiscs for final storage

  • Loss of function

    • Validate activity assays using positive controls

    • Minimize time between cell disruption and protein assay

    • Consider in vivo assays that don't require purification

When troubleshooting, systematic parameter variation and thorough documentation are essential for identifying optimal conditions for your specific research questions .

How should researchers design experiments to study the role of CbrB in bacterial pathogenesis and infection?

Investigating CbrB's role in pathogenesis requires a multi-faceted approach that spans from molecular mechanisms to infection models:

  • In vitro studies:

    • Adherence and invasion assays with host cells

    • Biofilm formation assays under various conditions

    • Stress resistance tests (acid, oxidative, antimicrobial)

  • Ex vivo approaches:

    • Survival in human serum or other relevant biological fluids

    • Interaction with isolated immune cells

    • Growth in tissue-specific media

  • In vivo infection models:

    • Compare colonization efficiency between wild-type and cbrB mutants

    • Assess competitive index in mixed infections

    • Measure bacterial burden in different tissues

    • Evaluate host immune response parameters

When designing these experiments, ensure you:

  • Include appropriate controls (complemented strains, other gene deletions)

  • Use clinically relevant conditions and strains

  • Consider temporal dynamics of infection

  • Address potential redundancy with other bacterial factors

Research on bacterial pathogenesis often benefits from community-based participatory research (CBPR) approaches that connect laboratory findings with clinical observations and community health concerns .

What emerging technologies show promise for advancing our understanding of CbrB function?

Several cutting-edge technologies are poised to transform research on inner membrane proteins like CbrB:

  • Cryo-electron tomography for visualizing membrane proteins in their native context

  • Single-molecule tracking in living bacteria to study protein dynamics

  • Microfluidics combined with time-lapse microscopy for real-time stress response studies

  • CRISPR interference for precise temporal control of gene expression

  • Advanced mass spectrometry techniques for analyzing membrane protein complexes

These technologies will enable researchers to address previously intractable questions about membrane protein function, dynamics, and interactions at unprecedented resolution .

How can findings from CbrB research contribute to broader understanding of bacterial stress responses and antimicrobial resistance?

Research on inner membrane proteins like CbrB has significant implications for understanding fundamental bacterial biology and developing new antimicrobial strategies:

  • Membrane proteins often serve as sensors for environmental conditions, providing insight into bacterial adaptation mechanisms

  • Understanding stress response systems may reveal vulnerabilities that can be targeted by new antimicrobials

  • Membrane protein research contributes to our knowledge of bacterial envelope biology, which is crucial for drug uptake and efflux

  • Bacterial resistance mechanisms often involve membrane-associated processes, making proteins like CbrB relevant to antimicrobial resistance studies

Future research directions should consider:

  • Integration of CbrB function with global bacterial stress response networks

  • Potential of CbrB or related proteins as targets for antivirulence strategies

  • Evolutionary conservation of CbrB function across bacterial species

  • Relationship between CbrB and established antimicrobial resistance mechanisms

The Centre for Bacterial Resistance Biology (CBRB) represents an institutional commitment to advancing this field through collaborative research efforts that connect molecular mechanisms to clinical outcomes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.