Recombinant Escherichia coli O9:H4 Inner Membrane Protein CbrB (cbrB) is a laboratory-produced protein derived from the E. coli O9:H4 serotype. It is primarily used in life sciences research, particularly for studying bacterial membrane biology, protein interactions, and pathogenicity mechanisms. The protein is expressed in heterologous systems such as E. coli or Shigella species, with His-tagged versions available for purification .
CbrB is utilized in enzyme-linked immunosorbent assays (ELISAs) to detect antibodies or study immune responses. For example:
Product Specifications: ELISA kits for CbrB include 50 µg of recombinant protein per vial, optimized for antibody detection in serum or tissue samples .
Applications: Supports studies on E. coli pathogenesis, particularly in serotypes linked to diarrheagenic E. coli (DEC) or STEAEC hybrids .
While E. coli O9 strains are often classified as commensal, some harbor DEC genes (e.g., aggR, aap) associated with enteropathogenicity . CbrB’s role in virulence is not explicitly documented, but its presence in pathogenic serotypes like O9:H4 suggests potential involvement in membrane stability or host interaction.
Recombinant CbrB is produced via high-cell-density fermentation, with protocols optimized for soluble protein yield. Industrial-scale processes involve phosphate-limited conditions to induce protein expression, as observed in similar E. coli systems .
| Segment | Sequence |
|---|---|
| N-Terminal | MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLLVIIQVLPLFLLLSITTGAIPALLTGVMVACLPEKIGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSE |
| C-Terminal | LFENILSGDSLVVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS |
Functional Studies: Direct evidence linking CbrB to bacterial survival, virulence, or membrane transport is lacking.
Pathogenicity: Further investigation is needed to determine whether CbrB contributes to the pathogenic potential of E. coli O9:H4, particularly in hybrid STEAEC strains .
Interaction Mapping: Proteomic studies could identify binding partners or pathways involving CbrB .
KEGG: ecx:EcHS_A3930
CbrB functions as an inner membrane protein in E. coli that appears to be involved in envelope stress responses and potentially copper homeostasis, similar to other inner membrane proteins like YhiM. The protein likely plays a role in the bacterial adaptation to environmental stresses by interacting with stress response systems such as CpxAR.
To study CbrB's membrane localization and function, researchers typically employ a combination of:
Subcellular fractionation to confirm membrane localization
Fluorescent protein tagging to visualize localization in vivo
Membrane protein topology mapping using PhoA/LacZ fusion analysis
Site-directed mutagenesis to identify functional domains
When conducting these experiments, it's critical to maintain the native membrane environment or use appropriate membrane mimetics to preserve protein function .
Expression of inner membrane proteins like CbrB presents unique challenges due to their hydrophobic domains and potential toxicity when overexpressed. Based on current practices with similar membrane proteins, the following expression strategies are recommended:
Use of specialized E. coli strains designed for membrane protein expression (C41/C43, Lemo21)
Expression under the control of tightly regulated promoters (T7lac or arabinose-inducible)
Optimization of induction conditions (lower temperatures of 16-25°C, reduced inducer concentrations)
Addition of fusion tags that enhance solubility and membrane insertion
For higher yields, the HlyA secretion system may be considered, as it has successfully secreted various structurally different proteins in E. coli. This approach would require fusion to the nontoxic 50-60 amino acid HlyA C-terminal domain, which is essential for protein translocation .
Verifying proper folding and function of membrane proteins like CbrB requires multiple complementary approaches:
Circular dichroism (CD) spectroscopy to assess secondary structure content
Limited proteolysis to evaluate compact domain formation
Functional assays specific to the protein's known or predicted activity
Complementation assays in cbrB knockout strains to test for functional restoration
When evaluating functionality, it's important to consider the protein's native environment. For copper-responsive inner membrane proteins, testing should include copper challenge assays and quantitative PCR (qPCR) analysis of stress response genes like cpxP, which has been shown to be upregulated during copper stress in similar systems .
Purifying inner membrane proteins while preserving their native structure requires careful consideration of detergents and buffer conditions:
| Purification Stage | Recommended Approach | Key Considerations |
|---|---|---|
| Membrane Extraction | Mild detergents (DDM, LMNG, or C12E8) | Concentration needs optimization to prevent protein denaturation |
| Affinity Chromatography | IMAC using His-tag | Include detergent above CMC in all buffers |
| Size Exclusion | Superdex 200 or similar | Assess oligomeric state in different detergents |
| Stability Assessment | Thermal shift assays with CPM dye | Monitor stability in various detergent/lipid combinations |
It's crucial to include protease inhibitors throughout the purification process and maintain consistent temperature conditions (typically 4°C) to minimize protein degradation .
The interaction between inner membrane proteins like CbrB and stress response systems such as CpxAR can be studied using sophisticated approaches that capture both physical interactions and functional relationships:
Bacterial two-hybrid assays specifically designed for membrane protein interactions
Co-immunoprecipitation with crosslinking to stabilize transient interactions
Förster resonance energy transfer (FRET) with fluorescently tagged proteins to detect interactions in living cells
Quantitative phosphoproteomics to track signaling cascades
Research on similar inner membrane proteins has shown that deletion mutants often exhibit significantly altered expression of stress response genes. For example, studies on YhiM demonstrated that a ΔyhiM mutant had significantly higher expression of cpxP than the wild-type strain under basal conditions, which further increased during copper stress .
To properly interpret these interactions, researchers should:
Perform gene expression analysis under various stress conditions
Correlate protein-protein interaction data with physiological responses
Use isogenic strains with specific mutations in key signaling components
Validate findings through complementation studies
Identifying the functional domains of membrane proteins like CbrB requires a multilayered approach combining computational prediction with experimental validation:
Initial domain prediction using bioinformatics tools (TMHMM, Phobius, TOPCONS)
Cysteine scanning mutagenesis to map topology and accessible regions
Hydrogen/deuterium exchange mass spectrometry to identify solvent-accessible regions
Cryo-electron microscopy for structural determination, particularly effective for membrane proteins
When analyzing results, it's important to correlate structural features with functional outcomes by generating a library of truncation and point mutants followed by functional assays. For inner membrane proteins involved in stress responses, researchers should assess:
Copper sensitivity in deletion mutants compared to wild-type strains
Expression levels of stress-responsive genes like cpxP under various conditions
Protein-protein interaction profiles with known components of stress response systems
Successful structure-function studies require careful control of experimental conditions to avoid artifacts from protein overexpression or improper membrane insertion .
The relationship between CbrB expression and stress resistance can be rigorously investigated through a combination of transcriptomic, proteomic, and phenotypic approaches:
RNA-Seq analysis under varying copper concentrations to establish expression patterns
Quantitative proteomics to correlate transcript levels with protein abundance
Phenotypic assays measuring growth curves under copper stress
Competition assays between wild-type and cbrB mutant strains
Based on research with similar inner membrane proteins, deletion mutants often show altered sensitivity to copper. For example, the ΔyhiM mutant exhibited increased resistance to copper compared to wild-type strains, indicating a complex relationship between inner membrane proteins and copper homeostasis .
When designing these experiments, researchers should:
Include appropriate controls for metal specificity (testing other metals besides copper)
Assess dose-dependent relationships
Consider temporal dynamics of gene expression and stress response
Account for potential compensatory mechanisms in deletion mutants
Studying protein interactions within the native membrane environment presents significant technical challenges that can be addressed through specialized approaches:
| Technique | Application | Advantages | Limitations |
|---|---|---|---|
| In vivo crosslinking | Captures transient interactions in native environment | Preserves physiological context | May produce false positives due to proximity |
| FRET/BRET | Real-time interaction monitoring | Works in living cells | Requires protein tagging that may affect function |
| Proximity labeling (BioID, APEX2) | Identifies proximal proteins | Doesn't require stable interactions | Spatial resolution limitations |
| Native mass spectrometry | Preserves intact protein complexes | Can determine stoichiometry | Technically challenging for membrane proteins |
When interpreting interaction data, researchers should be aware that membrane protein interactions are often influenced by lipid composition and membrane potential. Therefore, validation in multiple systems and under various conditions is essential to establish biologically meaningful interactions .
Distinguishing direct from indirect effects in CbrB functional studies requires a systematic approach:
Generate clean deletion mutants with minimal polar effects on adjacent genes
Create complementation strains expressing wild-type CbrB from plasmids or in trans
Develop point mutants that affect specific functions rather than the entire protein
Use inducible expression systems to control timing and level of expression
For data analysis, researchers should:
Compare transcriptomic and proteomic profiles between knockout, complemented, and wild-type strains
Apply network analysis to identify primary versus secondary effects
Perform time-course experiments to establish the sequence of cellular events
Consider epistasis analysis with related genes in the same pathway
Studies on similar inner membrane proteins have shown that deletion mutants often exhibit complex phenotypes that reflect both direct effects and compensatory responses. For example, the increased resistance to copper in a ΔyhiM mutant was linked to activation of the CpxAR envelope stress response system, demonstrating the interconnected nature of these response pathways .
Working with recombinant inner membrane proteins like CbrB presents several challenges that researchers should anticipate and address:
Low expression levels
Optimize codon usage for E. coli
Test multiple expression strains and conditions
Consider specialized vectors designed for membrane proteins
Protein misfolding
Express at lower temperatures (16-20°C)
Include membrane-mimetic environments during purification
Test fusion partners that enhance folding (MBP, SUMO)
Aggregation during purification
Screen multiple detergents at various concentrations
Include lipids in purification buffers
Consider amphipols or nanodiscs for final storage
Loss of function
Validate activity assays using positive controls
Minimize time between cell disruption and protein assay
Consider in vivo assays that don't require purification
When troubleshooting, systematic parameter variation and thorough documentation are essential for identifying optimal conditions for your specific research questions .
Investigating CbrB's role in pathogenesis requires a multi-faceted approach that spans from molecular mechanisms to infection models:
In vitro studies:
Adherence and invasion assays with host cells
Biofilm formation assays under various conditions
Stress resistance tests (acid, oxidative, antimicrobial)
Ex vivo approaches:
Survival in human serum or other relevant biological fluids
Interaction with isolated immune cells
Growth in tissue-specific media
In vivo infection models:
Compare colonization efficiency between wild-type and cbrB mutants
Assess competitive index in mixed infections
Measure bacterial burden in different tissues
Evaluate host immune response parameters
When designing these experiments, ensure you:
Include appropriate controls (complemented strains, other gene deletions)
Use clinically relevant conditions and strains
Consider temporal dynamics of infection
Address potential redundancy with other bacterial factors
Research on bacterial pathogenesis often benefits from community-based participatory research (CBPR) approaches that connect laboratory findings with clinical observations and community health concerns .
Several cutting-edge technologies are poised to transform research on inner membrane proteins like CbrB:
Cryo-electron tomography for visualizing membrane proteins in their native context
Single-molecule tracking in living bacteria to study protein dynamics
Microfluidics combined with time-lapse microscopy for real-time stress response studies
CRISPR interference for precise temporal control of gene expression
Advanced mass spectrometry techniques for analyzing membrane protein complexes
These technologies will enable researchers to address previously intractable questions about membrane protein function, dynamics, and interactions at unprecedented resolution .
Research on inner membrane proteins like CbrB has significant implications for understanding fundamental bacterial biology and developing new antimicrobial strategies:
Membrane proteins often serve as sensors for environmental conditions, providing insight into bacterial adaptation mechanisms
Understanding stress response systems may reveal vulnerabilities that can be targeted by new antimicrobials
Membrane protein research contributes to our knowledge of bacterial envelope biology, which is crucial for drug uptake and efflux
Bacterial resistance mechanisms often involve membrane-associated processes, making proteins like CbrB relevant to antimicrobial resistance studies
Future research directions should consider:
Integration of CbrB function with global bacterial stress response networks
Potential of CbrB or related proteins as targets for antivirulence strategies
Evolutionary conservation of CbrB function across bacterial species
Relationship between CbrB and established antimicrobial resistance mechanisms
The Centre for Bacterial Resistance Biology (CBRB) represents an institutional commitment to advancing this field through collaborative research efforts that connect molecular mechanisms to clinical outcomes .