Recombinant Escherichia coli O9:H4 NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; EcHS_A2437; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
nuoA
Target Protein Sequence
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSA RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRI GALDWTPARSRRERMNPETNSIANRQR
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is nuoA and what is its role in Escherichia coli?

NuoA is a small membrane spanning subunit of respiratory chain NADH:quinone oxidoreductase (complex I). It plays a crucial role in the electron transport chain and cellular respiration in E. coli. Unlike other complex I core protein subunits, the NuoA protein has no known homologue in other enzyme systems, making it a unique component of bacterial respiration .

The protein is essential for the proper assembly and function of complex I, which catalyzes the transfer of electrons from NADH to quinone, coupled with proton translocation across the membrane. This process generates the proton motive force necessary for ATP synthesis in bacterial cells.

What are the structural characteristics of nuoA protein?

NuoA is characterized by its small size and membrane-spanning nature. The transmembrane orientation of NuoA cannot be unambiguously predicted due to the small size of the polypeptide and the varying distribution of charged amino acid residues in NuoA from different organisms .

Research using fusion protein approaches has demonstrated that the C-terminal end of the nuoA polypeptide from E. coli is localized in the bacterial cytoplasm . This finding contradicts earlier reports regarding the homologous NQO7 subunit from Paracoccus denitrificans complex I, highlighting the unique structural characteristics of nuoA in E. coli.

What are the recommended methods for expressing recombinant nuoA in E. coli?

The expression of recombinant nuoA requires careful consideration of several factors due to its membrane-spanning nature. A systematic approach includes:

  • Vector selection: Use expression vectors with inducible promoters (such as T7 or tac) to control expression levels.

  • Host strain selection: E. coli strains like BL21(DE3) or C43(DE3) are often preferred for membrane protein expression.

  • Expression conditions: Optimize temperature (typically 18-30°C), inducer concentration, and expression duration.

  • Fusion tags: Consider adding fusion tags at either the N- or C-terminus to facilitate detection and purification.

For nuoA specifically, fusion protein approaches with reporter proteins like cytochrome c and alkaline phosphatase have been successfully employed to study its transmembrane orientation . These fusion proteins can also aid in protein detection and purification.

What purification strategies are most effective for recombinant nuoA protein?

Purification of membrane proteins like nuoA requires specialized approaches:

  • Membrane isolation: First isolate the membrane fraction through differential centrifugation.

  • Solubilization: Select appropriate detergents (such as n-dodecyl-β-D-maltoside, DDM, or digitonin) to solubilize the membrane while maintaining protein structure.

  • Affinity chromatography: If fusion tags are present, use corresponding affinity resins for initial purification.

  • Size exclusion chromatography: Further purify the protein based on size to achieve >95% purity.

For nuoA specifically, maintaining the native folding during purification is critical. Mild detergents and buffer conditions that mimic the membrane environment help preserve protein structure.

How can researchers accurately determine the transmembrane orientation of nuoA?

Determining the transmembrane orientation of nuoA requires multiple complementary approaches:

  • Fusion protein approach: Express nuoA as fusion proteins with reporters whose activities depend on their cellular localization (cytoplasmic vs. periplasmic). This approach was successfully used to demonstrate that the C-terminal end of nuoA is located in the bacterial cytoplasm .

  • Protease accessibility assays: Treat membrane vesicles with proteases, followed by mass spectrometry analysis to identify exposed regions.

  • Cysteine scanning mutagenesis: Introduce cysteine residues at different positions and probe their accessibility with membrane-permeable and -impermeable reagents.

  • Computational prediction: Use multiple prediction algorithms and compare results, although for nuoA these predictions may be ambiguous due to its small size and distribution of charged residues .

How does nuoA interact with other subunits of complex I?

The interaction of nuoA with other complex I subunits can be studied through various approaches:

  • Crosslinking studies: Use chemical crosslinkers with specific spacer lengths to identify neighboring subunits.

  • Co-immunoprecipitation: Employ antibodies against nuoA to pull down interacting partners.

  • Blue Native PAGE: Analyze intact complexes and subcomplexes to determine assembly intermediates involving nuoA.

  • Molecular dynamics simulations: Predict interactions based on structural models.

Research indicates that nuoA likely interacts closely with other membrane subunits of complex I, helping to form the proton-translocation machinery. Its unique topology, with the C-terminus in the cytoplasm , suggests it may also interact with peripheral subunits involved in electron transfer.

What are the functional consequences of nuoA mutations on complex I activity?

Studying the effects of nuoA mutations requires a systematic approach:

  • Site-directed mutagenesis: Target conserved residues or regions predicted to be important for structure or function.

  • Enzymatic activity assays: Measure NADH:quinone oxidoreductase activity using artificial electron acceptors like ferricyanide.

  • Proton translocation assays: Assess the impact on proton pumping using pH-sensitive fluorescent dyes.

  • Growth phenotype analysis: Evaluate growth under conditions requiring functional complex I.

  • Assembly analysis: Determine if mutations affect complex I assembly using Blue Native PAGE.

Key residues likely important for nuoA function include those involved in membrane spanning and those at the C-terminus, which is localized in the cytoplasm and may participate in interactions with other subunits .

How does the nuoA structure differ between bacterial species, and what are the functional implications?

Comparative analysis of nuoA across bacterial species reveals:

To study these differences:

  • Perform multiple sequence alignments to identify conserved and variable regions

  • Compare predicted transmembrane topologies

  • Express recombinant nuoA from different organisms in a common host to compare functional properties

  • Use homology modeling to predict structural differences

What are common challenges in nuoA research and how can they be addressed?

Working with nuoA presents several challenges:

  • Low expression levels:

    • Solution: Optimize codon usage for E. coli expression

    • Use specialized strains like C43(DE3) designed for membrane protein expression

    • Consider using fusion partners that enhance expression

  • Protein aggregation:

    • Solution: Express at lower temperatures (16-20°C)

    • Screen different detergents for solubilization

    • Consider using fusion partners that enhance solubility

  • Difficult purification:

    • Solution: Implement multi-step purification strategies

    • Use mild detergents that maintain native structure

    • Consider purifying as part of subcomplexes rather than individual subunits

  • Ambiguous transmembrane prediction:

    • Solution: Use multiple experimental approaches as described earlier

    • Compare results from multiple prediction algorithms

    • Validate findings using biochemical approaches

How can researchers distinguish between properly folded and misfolded recombinant nuoA?

Assessing the proper folding of nuoA requires multiple approaches:

  • Circular dichroism spectroscopy: Analyze secondary structure content.

  • Fluorescence spectroscopy: Assess the environment of aromatic residues.

  • Limited proteolysis: Properly folded proteins often show distinct proteolytic patterns.

  • Functional reconstitution: Incorporate purified nuoA into liposomes or nanodiscs and assess function.

  • Thermal stability assays: Monitor unfolding transitions using techniques like differential scanning fluorimetry.

For nuoA specifically, successful incorporation into membranes and correct orientation (C-terminus in the cytoplasm) are important indicators of proper folding.

What controls should be included in experiments involving recombinant nuoA?

Rigorous experimental design for nuoA research should include:

  • Positive controls:

    • Wild-type nuoA expressed under identical conditions

    • Known functional complex I preparations

  • Negative controls:

    • Empty vector expressions

    • Inactive mutants (if available)

    • Denatured protein samples

  • Technical controls:

    • Assessment of membrane fraction purity

    • Verification of protein identity by mass spectrometry

    • Confirmation of transmembrane orientation using established markers

  • Validation approaches:

    • Complementation of nuoA-deficient strains

    • Comparison of results using multiple detection methods

    • Verification that fusion tags don't interfere with function

How should researchers analyze nuoA transmembrane topology data?

Proper analysis of nuoA topology data requires:

  • Integration of multiple approaches: Compare results from fusion protein studies, proteolytic accessibility, and computational predictions.

  • Statistical validation: Perform replicate experiments and apply appropriate statistical tests.

  • Data visualization: Create topology models that integrate all experimental evidence.

  • Comparative analysis: Compare findings with known topology of homologous proteins.

For E. coli nuoA specifically, researchers should be aware of the established finding that the C-terminal end is localized in the bacterial cytoplasm , which differs from some homologous proteins. Any contradicting results should be carefully evaluated and validated with multiple approaches.

What statistical methods are appropriate for analyzing nuoA functional data?

Statistical analysis of nuoA functional data should include:

  • Descriptive statistics: Calculate means, standard deviations, and coefficients of variation.

  • Inferential statistics:

    • Use t-tests for comparing two conditions

    • Use ANOVA for comparing multiple conditions

    • Apply appropriate post-hoc tests (e.g., Tukey's test)

  • Regression analysis: For dose-response relationships or time-course studies.

  • Non-parametric tests: When data doesn't meet assumptions for parametric tests.

  • Sample size determination: Calculate required sample sizes to achieve adequate statistical power.

Statistical TestApplicationAssumptions
Student's t-testComparing two groupsNormal distribution, equal variances
ANOVAComparing multiple groupsNormal distribution, equal variances
Mann-Whitney U testNon-parametric alternative to t-testDoes not require normal distribution
Kruskal-Wallis testNon-parametric alternative to ANOVADoes not require normal distribution
Linear regressionAnalyzing relationships between variablesLinearity, independence, homoscedasticity

What are the latest techniques being applied to study nuoA structure and function?

Recent advances in nuoA research include:

  • Cryo-electron microscopy: Enabling visualization of complex I structure at near-atomic resolution, providing insights into nuoA's position and interactions.

  • Native mass spectrometry: Analyzing intact membrane protein complexes and their interactions.

  • Single-molecule techniques: Studying conformational changes during function.

  • Nanodiscs and liposome reconstitution: Creating defined membrane environments for functional studies.

  • CRISPR-Cas9 genome editing: Generating precise chromosomal modifications to study nuoA in its native context.

These advanced techniques complement traditional approaches and provide new insights into nuoA's role in complex I structure and function.

How does nuoA research contribute to understanding bacterial bioenergetics?

Research on nuoA contributes significantly to understanding bacterial energy metabolism:

  • Elucidating complex I mechanism: As a unique component of complex I with no homologues in other systems , nuoA studies help understand the specific mechanisms of bacterial NADH:quinone oxidoreductases.

  • Membrane protein topology: Research on nuoA topology, such as the finding that its C-terminus is located in the cytoplasm , contributes to broader understanding of membrane protein orientation determination.

  • Species-specific adaptations: Comparative studies of nuoA across bacterial species reveal adaptations in respiratory chains.

  • Antimicrobial target identification: As part of a critical energy-generating complex, nuoA studies can inform development of new antimicrobials targeting bacterial respiration.

What are promising future directions for nuoA research?

Future nuoA research directions include:

  • High-resolution structural studies: Obtaining atomic-resolution structures of nuoA within complex I in different conformational states.

  • Dynamics and conformational changes: Investigating how nuoA might change conformation during the catalytic cycle.

  • Comparative genomics and evolution: Exploring how nuoA has evolved across bacterial species and its relationship to energy metabolism adaptations.

  • Protein engineering: Modifying nuoA to alter complex I properties for biotechnological applications.

  • Systems biology integration: Understanding nuoA's role in the broader context of cellular metabolism and adaptation to different growth conditions.

These directions will provide deeper insights into the fundamental role of nuoA in bacterial bioenergetics and potentially lead to applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.