Recombinant Escherichia coli O9:H4 NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Escherichia coli O9:H4?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the NADH dehydrogenase I complex (NDH-1) in Escherichia coli O9:H4. It functions as part of the respiratory chain, contributing to energy metabolism in bacterial cells. This protein is encoded by the nuoK gene (locus name: EcHS_A2428) and has been assigned the UniProt accession number A8A2E8 . The full protein sequence consists of 100 amino acids and contains multiple transmembrane domains that facilitate its integration into the bacterial inner membrane, where it participates in electron transport processes.

What is the amino acid sequence and structural features of E. coli O9:H4 nuoK?

The complete amino acid sequence of E. coli O9:H4 nuoK is: MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG .

This protein exhibits key structural features:

• Contains multiple transmembrane domains with hydrophobic amino acid stretches

• Includes an N-terminal region with the sequence MIPLQHGLI that likely faces the cytoplasm

• Features conserved charged residues (arginine and lysine) that are important for function

• Has a molecular weight of approximately 11.4 kDa

• Contains a high proportion of hydrophobic residues consistent with its membrane-spanning function

How does nuoK function within the NADH-quinone oxidoreductase complex?

NuoK functions as a critical structural and functional component of NADH-quinone oxidoreductase (EC 1.6.99.5), which is also known as Complex I of the respiratory chain . This complex catalyzes the transfer of electrons from NADH to ubiquinone, coupled with proton translocation across the membrane.

The specific roles of nuoK include:

• Forming part of the membrane domain of Complex I

• Contributing to the proton translocation pathway

• Maintaining the structural integrity of the membrane arm of the complex

• Interacting with adjacent subunits to stabilize the quaternary structure

• Potentially participating in quinone binding

The transmembrane helices of nuoK align with other membrane subunits to form proton-conducting channels, essential for the bioenergetic function of the complex.

What are the optimal expression systems for producing recombinant nuoK protein?

For effective expression of recombinant nuoK, several expression systems can be employed, with E. coli-based systems being the most common due to their efficiency for proteins that do not require complex post-translational modifications :

The expression strategy should include:

• Selection of vectors with controlled promoters (λPL or T7)

• Optimization of induction conditions (temperature, IPTG concentration)

• Consideration of fusion partners to enhance solubility

• Use of E. coli strains specifically engineered for membrane protein expression

• Implementation of cold-shock protocols to slow expression and improve folding

What purification strategies yield the highest purity and activity for recombinant nuoK?

Purification of recombinant nuoK requires specialized techniques due to its hydrophobic nature:

• Solubilization Stage:

  • Membrane fraction isolation through ultracentrifugation

  • Selection of appropriate detergents (DDM, LDAO, or C12E8)

  • Optimization of detergent concentration to maintain protein structure

• Chromatography Sequence:

  • Immobilized metal affinity chromatography (IMAC) with histidine-tagged protein

  • Size exclusion chromatography to remove aggregates

  • Ion exchange chromatography for final polishing

• Quality Control Assessments:

  • SDS-PAGE analysis for purity (target >95%)

  • Western blotting for identity confirmation

  • Mass spectrometry for sequence verification

  • Activity assays measuring NADH oxidation rates

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C to maintain stability, with caution against repeated freeze-thaw cycles .

How can researchers troubleshoot low expression yields of recombinant nuoK?

When encountering low expression yields of recombinant nuoK, researchers should systematically address:

• Genetic Construct Issues:

  • Verify codon optimization for E. coli

  • Check for rare codons and optimize if necessary

  • Ensure the absence of secondary structures in mRNA

  • Confirm promoter and ribosome binding site functionality

• Expression Conditions:

  • Modify induction parameters (temperature reduction to 16-20°C)

  • Alter inducer concentration (typically 0.1-0.5 mM IPTG)

  • Test different media formulations (TB, 2XYT vs. LB)

  • Implement extended expression time (16-24 hours)

• Toxicity Mitigation:

  • Use tightly regulated expression systems

  • Consider leak-proof promoters like pBAD

  • Utilize C41/C43 strains designed for toxic membrane proteins

  • Implement glucose repression for basal expression control

• Protein Stability Enhancement:

  • Add stabilizing agents (glycerol, specific lipids)

  • Include protease inhibitors during all handling steps

  • Maintain sample temperature below 4°C during processing

  • Consider co-expression with chaperones (GroEL/GroES)

Implementing a systematic optimization approach addressing these parameters can significantly improve yields from sub-milligram to multiple milligrams per liter of culture.

What techniques are most effective for studying the structure-function relationship of nuoK?

To elucidate the structure-function relationship of nuoK, researchers should employ complementary approaches:

• Computational Methods:

  • Homology modeling based on related structures

  • Molecular dynamics simulations to study conformational changes

  • Prediction of transmembrane domains and protein-protein interaction sites

  • Evolutionary analysis to identify conserved functional residues

• Biophysical Techniques:

  • Circular dichroism (CD) spectroscopy for secondary structure determination

  • Fourier transform infrared spectroscopy (FTIR) for membrane protein structure

  • Nuclear magnetic resonance (NMR) for dynamic studies in a membrane environment

  • X-ray crystallography or cryo-EM for high-resolution structural information

• Functional Assays:

  • Site-directed mutagenesis of conserved residues

  • Reconstitution into liposomes to measure proton translocation

  • NADH:ubiquinone oxidoreductase activity measurements

  • Membrane potential measurements using fluorescent probes

• Interaction Studies:

  • Cross-linking experiments to identify interacting partners

  • Co-immunoprecipitation of complex components

  • Proteolytic mapping to identify exposed regions

  • Blue native PAGE to study complex assembly

These approaches should be integrated to create a comprehensive understanding of how the structural elements of nuoK contribute to its role in the NADH-quinone oxidoreductase complex.

How does the amino acid sequence of nuoK influence its integration into the respiratory complex?

The amino acid sequence of nuoK plays a crucial role in its proper integration into the NADH-quinone oxidoreductase complex:

• Transmembrane Domain Organization:
  The sequence "MIPLAAILFVLGLTGLVIRRN" contains predominantly hydrophobic residues that form transmembrane helices . These helices interact with membrane phospholipids and adjacent subunits through:

  • Van der Waals interactions between hydrophobic side chains

  • Hydrogen bonding near helix termini

  • Electrostatic interactions with charged residues

• Interface Residues:
  Specific residues in the sequence form interaction surfaces with adjacent subunits:

  • Charged residues (R, K, D, E) form salt bridges

  • Aromatic residues (F, Y, W) participate in π-stacking interactions

  • Small residues (G, A) allow close packing between subunits

• Assembly Determinants:
  The C-terminal region "HRRRQNLNIDSVSEMRG" contains charged residues that likely participate in electrostatic interactions critical for complex assembly .

• Evolutionary Conservation:
  Comparison across bacterial species reveals highly conserved residues essential for:

  • Complex assembly

  • Proton translocation

  • Structural stability

  • Quinone binding

Mutations in these conserved regions typically result in impaired complex formation or dysfunction, highlighting their importance in the structural organization of the respiratory complex.

How does the nuoK protein from E. coli O9:H4 compare to other E. coli strains?

Comparative analysis of nuoK across E. coli strains reveals important insights:

These variations, while subtle, may influence:

• Protein-protein interactions within the respiratory complex

• Efficiency of proton translocation

• Stability of the protein in the membrane environment

• Assembly kinetics of the complex

The high conservation across strains indicates strong evolutionary pressure to maintain nuoK function, with variations potentially reflecting adaptations to specific ecological niches or metabolic requirements of different E. coli pathotypes .

What is the significance of the antigenic relationship between E. coli O9 and O104 serogroups in research contexts?

The antigenic relationship between E. coli O9 and O104 serogroups has significant implications for research:

• Serological Cross-Reactivity:
  Studies have demonstrated that anti-O9 serum shows reactivity with O104 antigens at dilutions of 1:400, while anti-O104 serum reacts with O9 antigens at dilutions of 1:200 . This cross-reactivity indicates shared epitopes between these serogroups that may complicate:

  • Serological identification of strains

  • Epidemiological tracking

  • Vaccine development

  • Diagnostic test specificity

• Evolutionary Significance:
  The shared antigenic determinants suggest:

  • Common evolutionary origins

  • Horizontal gene transfer of O-antigen biosynthesis genes

  • Selection pressures maintaining similar surface structures

  • Potential functional advantages of these specific O-antigens

• Research Implications:
  This relationship necessitates:

  • Careful absorption studies when developing serotyping reagents

  • Use of multiple identification methods beyond serology

  • Consideration of cross-reactivity when interpreting experimental results

  • Molecular approaches to supplement serological identification

• Epidemiological Relevance:
  Given that O104:H4 gained significance during the 2011 European outbreak , understanding its relationship with O9 strains provides:

  • Insights into the emergence of virulent strains

  • Potential surveillance targets

  • Context for genetic recombination events

  • Framework for tracking strain evolution

The careful distinction between these serogroups requires absorption of antisera with heterologous antigens to ensure accurate identification in research settings .

How can recombinant nuoK be used to study bacterial energy metabolism?

Recombinant nuoK serves as a valuable tool for investigating bacterial energy metabolism through multiple approaches:

• Reconstitution Studies:

  • Purified nuoK can be incorporated into proteoliposomes along with other Complex I subunits

  • This system allows measurement of:

    • Proton translocation efficiency

    • NADH oxidation rates

    • Response to inhibitors

    • Membrane potential generation

• Structure-Function Investigations:

  • Site-directed mutagenesis of conserved residues enables:

    • Identification of residues essential for proton translocation

    • Understanding of electron transfer coupling mechanisms

    • Elucidation of quinone-binding interactions

    • Mapping of conformational changes during catalysis

• Comparative Bioenergetics:

  • Expression of nuoK variants from different bacterial species permits:

    • Evolutionary analysis of respiratory mechanisms

    • Identification of species-specific adaptations

    • Correlation of sequence variations with metabolic efficiency

    • Insights into bacterial adaptation to different energy sources

• Drug Development Applications:

  • As part of the respiratory chain, nuoK represents a potential antibiotic target:

    • Screening assays using recombinant protein can identify inhibitors

    • Structure-based drug design targeting nuoK-specific features

    • Development of species-selective respiratory inhibitors

    • Evaluation of resistance mechanisms

These applications contribute to our fundamental understanding of bacterial metabolism while offering potential translational benefits for antimicrobial development.

What are the methodological considerations for studying protein-protein interactions involving nuoK?

Investigating protein-protein interactions of nuoK requires specialized approaches due to its membrane-embedded nature:

• In Vitro Methods:

  • Cross-linking Studies:

    • Chemical cross-linkers of varying lengths can capture interactions

    • Mass spectrometry analysis identifies interaction partners

    • Requires careful optimization of cross-linker concentration and reaction time

    • Should be performed in native membrane environments when possible

  • Co-purification Approaches:

    • Tandem affinity purification with tagged nuoK

    • Pull-down assays using immobilized nuoK as bait

    • Size exclusion chromatography to isolate intact complexes

    • Blue native PAGE to preserve native protein complexes

• In Silico Predictions:

  • Molecular docking simulations

  • Coevolutionary analysis of sequence alignments

  • Protein-protein interaction interface prediction

  • Molecular dynamics simulations of complex formation

• In Vivo Methods:

  • Two-hybrid Systems Modified for Membrane Proteins:

    • Split-ubiquitin yeast two-hybrid system

    • Bacterial adenylate cyclase two-hybrid system (BACTH)

    • Optimization required for membrane protein expression

  • In Vivo Cross-linking:

    • Photo-activatable amino acid incorporation

    • In vivo chemical cross-linking followed by purification

    • Proximity labeling approaches (BioID, APEX)

• Validation Approaches:

  • Mutagenesis of predicted interface residues

  • Competition assays with peptide fragments

  • FRET/BRET analysis of tagged proteins

  • Functional assays measuring complex activity

These methodological approaches should be combined to build a comprehensive interactome map of nuoK within the respiratory complex and potentially with other cellular components.

How can researchers effectively analyze the impact of nuoK mutations on respiratory complex assembly and function?

To systematically analyze the impact of nuoK mutations on respiratory complex assembly and function, researchers should implement a multi-faceted approach:

• Mutation Design Strategy:

  • Conservation-based Selection:

    • Identify residues conserved across species

    • Target charged residues in transmembrane regions

    • Focus on residues at predicted subunit interfaces

    • Consider known disease-associated mutations in homologs

  • Mutation Classifications:

    • Conservative (similar physicochemical properties)

    • Non-conservative (altered charge or hydrophobicity)

    • Deletions or insertions

    • Chimeric constructs with related proteins

• Assembly Analysis:

  • Quantitative Techniques:

    • Blue native PAGE with densitometry

    • Size exclusion chromatography profiles

    • Analytical ultracentrifugation

    • Mass photometry of intact complexes

  • Localization Studies:

    • Immunofluorescence microscopy

    • Membrane fractionation efficiency

    • Protease accessibility assays

    • Green fluorescent protein fusion localization

• Functional Assessment:

  • Activity Measurements:

    • NADH:ubiquinone oxidoreductase activity

    • Oxygen consumption rates

    • Proton pumping efficiency

    • Membrane potential generation

  • Inhibitor Sensitivity:

    • Altered IC50 values for known inhibitors

    • Resistance profiles

    • Competitive inhibition kinetics

    • Cross-resistance patterns

• Structural Analysis:

  • Hydrogen-deuterium exchange mass spectrometry

  • Limited proteolysis accessibility

  • Thermal stability shifts

  • Cryo-EM structural analysis when feasible

• Data Integration Framework:

  • Correlation of structure, assembly, and function

  • Machine learning approaches to predict mutation impacts

  • Molecular dynamics simulations to rationalize experimental findings

  • Evolutionary analysis to interpret mutation significance

This comprehensive approach allows researchers to establish structure-function relationships at the residue level and understand the molecular basis of nuoK's role in the respiratory complex.

What controls are essential when designing experiments with recombinant nuoK?

Rigorous experimental design for recombinant nuoK research requires implementation of appropriate controls:

• Expression Controls:

  • Negative Controls:

    • Empty vector transformants

    • Inactive mutant versions (e.g., key residue mutations)

    • Non-induced cultures for inducible systems

    • Host cells without expression vector

  • Positive Controls:

    • Well-characterized membrane protein with similar properties

    • Previously validated nuoK preparation

    • Commercial NADH dehydrogenase (for activity comparisons)

    • Intact bacterial membranes with native complex

• Purification Controls:

  • Control protein subjected to identical purification procedure

  • Deliberately denatured samples to establish baseline

  • Detergent-only samples to assess micelle effects

  • Time-course stability samples to monitor degradation

• Activity Assay Controls:

  • Enzyme-free reaction mixtures

  • Heat-inactivated enzyme preparations

  • Known inhibitor treatments

  • Substrate analogs incapable of reaction

• Specificity Controls:

  • Closely related NADH dehydrogenase subunits

  • Cross-species nuoK homologs

  • Deliberately misfolded protein preparations

  • Competitive inhibition with excess substrate

• Technical Validation:

  • Multiple independent protein preparations

  • Different expression batches

  • Alternative detection methods

  • Randomized sample analysis order

Implementation of these controls ensures experimental rigor and facilitates reliable interpretation of results, particularly important when working with membrane proteins that present unique experimental challenges.

How can researchers effectively validate the functionality of purified recombinant nuoK?

Validating the functionality of purified recombinant nuoK requires multiple complementary approaches:

• Structural Integrity Assessment:

  • Circular dichroism spectroscopy to confirm secondary structure

  • Tryptophan fluorescence emission spectra

  • Size exclusion chromatography profiles

  • Thermal stability analysis

• Biochemical Activity Assays:

  • Direct NADH Oxidation Measurement:

    • Spectrophotometric monitoring at 340 nm

    • Coupling with artificial electron acceptors

    • Competition with known inhibitors

    • Determination of kinetic parameters (Km, Vmax)

  • Proton Translocation Assays:

    • pH-sensitive fluorescent probes in proteoliposomes

    • Ion-selective electrode measurements

    • Membrane potential generation using voltage-sensitive dyes

    • Proton/electron stoichiometry determination

• Integration Capacity:

  • Ability to associate with other complex I subunits

  • Reconstitution into artificial membrane systems

  • Complementation of nuoK-deficient bacterial strains

  • Co-purification with known interaction partners

• Comparative Analysis:

  • Parallel testing with native complex

  • Comparison to related model systems

  • Benchmarking against published activity values

  • Activity ratios with different substrates/conditions

• Stability Assessment:

  • Activity retention after storage

  • Resistance to multiple freeze-thaw cycles

  • Thermal inactivation profiles

  • Detergent compatibility testing

A comprehensive validation approach combining these methods provides confidence in the functional integrity of the purified recombinant protein and establishes its suitability for downstream applications.

What are the challenges and solutions for studying recombinant membrane proteins like nuoK?

Membrane proteins like nuoK present unique research challenges that require specialized approaches:

• Expression Challenges:

  • Toxicity to Host Cells:

    • Solution: Use tightly controlled expression systems

    • Implementation: C41/C43 E. coli strains designed for toxic membrane proteins

    • Application: Tunable promoters allowing moderated expression levels

  • Misfolding and Aggregation:

    • Solution: Optimize expression temperature and induction conditions

    • Implementation: 16-20°C expression with low inducer concentrations

    • Application: Co-expression with chaperones like DnaK/DnaJ/GrpE

• Purification Challenges:

  • Detergent Selection:

    • Challenge: Maintaining native structure during solubilization

    • Solution: Systematic screening of detergent types and concentrations

    • Implementation: Mild detergents like DDM, LMNG, or GDN

  • Protein Stability:

    • Challenge: Rapid degradation during handling

    • Solution: Addition of stabilizing agents

    • Implementation: Glycerol, specific lipids, and cholesterol hemisuccinate

• Functional Analysis Challenges:

  • Artificial Environment Effects:

    • Challenge: Detergent micelles differ from native membrane

    • Solution: Reconstitution into lipid nanodiscs or proteoliposomes

    • Implementation: Matching lipid composition to native environment

  • Complex Assembly:

    • Challenge: Individual subunit may lack activity

    • Solution: Co-expression or reconstitution strategies

    • Implementation: Polycistronic constructs for coordinated expression

• Structural Analysis Challenges:

  • Conformational Heterogeneity:

    • Challenge: Multiple conformational states

    • Solution: Conformation-stabilizing ligands or mutations

    • Implementation: Nanobodies or designed binding proteins

  • Crystallization Difficulties:

    • Challenge: Detergent interferes with crystal contacts

    • Solution: Alternative structural techniques

    • Implementation: Cryo-EM, NMR for smaller constructs

These specialized approaches enable successful study of challenging membrane proteins like nuoK, allowing researchers to overcome the inherent difficulties associated with these important biological components.

How does the research on E. coli O9:H4 nuoK contribute to our understanding of bacterial pathogenicity?

The study of nuoK from E. coli O9:H4 provides valuable insights into bacterial pathogenicity through several mechanisms:

• Energy Metabolism and Virulence Connection:

  • Efficient energy generation via respiratory complexes supports:

    • Rapid growth during infection

    • Adaptation to nutrient-limited host environments

    • Persistence under stress conditions

    • Biofilm formation capability

• Serotype-Specific Factors:

  • E. coli O9:H4 belongs to a group with significant pathogenic potential:

    • O9 serogroup shows antigenic relationship with O104

    • O104:H4 caused a severe outbreak in Europe in 2011

    • Understanding conserved respiratory components across serotypes helps identify common virulence mechanisms

    • Comparative analysis reveals adaptations specific to pathogenic strains

• Host-Pathogen Interaction Insights:

  • Respiratory adaptation during infection:

    • Oxygen availability varies across infection sites

    • NADH-quinone oxidoreductase function critical under microaerobic conditions

    • Different efficiency of energy generation may contribute to tissue tropism

    • Metabolic adaptations influence competitive fitness in host

• Therapeutic Target Potential:

  • Research on nuoK contributes to:

    • Identification of respiratory chain vulnerabilities

    • Development of serotype-specific inhibitors

    • Understanding of resistance mechanisms

    • Novel antimicrobial strategies targeting energy metabolism

The molecular characterization of nuoK in E. coli O9:H4 thus bridges fundamental biochemistry with pathogenesis research, offering insights into how basic cellular functions contribute to virulence and potential approaches for therapeutic intervention.

What recent technological advances have improved the study of membrane proteins like nuoK?

Recent technological advances have revolutionized membrane protein research, offering new opportunities for studying proteins like nuoK:

• Structural Biology Breakthroughs:

  • Cryo-Electron Microscopy Advances:

    • Direct electron detectors enabling atomic resolution

    • Classification algorithms for conformational heterogeneity

    • Sample preparation innovations reducing preferred orientation

    • Application to smaller membrane proteins previously inaccessible

  • Innovative Crystallization Approaches:

    • Lipidic cubic phase crystallization

    • Crystal-free electron diffraction (MicroED)

    • XFEL-based serial crystallography

    • Antibody-mediated crystallization

• Membrane Mimetic Systems:

  • Nanodisc Technology:

    • MSP-based nanodiscs with controlled size

    • Polymer-based nanodiscs (SMALPs, DIBMA)

    • Native nanodiscs preserving endogenous lipid environments

    • High-density lipoprotein particles as membrane mimetics

  • Advanced Liposome Technology:

    • Controlled composition proteoliposomes

    • Giant unilamellar vesicles for single-particle studies

    • Asymmetric bilayers mimicking biological membranes

    • Tethered vesicle systems for long-term stability

• Cutting-Edge Spectroscopic Methods:

  • Single-Molecule Techniques:

    • FRET-based conformational dynamics studies

    • High-speed AFM for real-time visualization

    • Patch-clamp fluorometry combining functional and structural data

    • Single-molecule force spectroscopy

  • Advanced EPR Applications:

    • DEER/PELDOR for distance measurements

    • ENDOR for interaction characterization

    • High-field EPR for improved resolution

    • Spin-labeling strategies for membrane proteins

• Computational Advances:

  • Molecular Dynamics Capabilities:

    • Specialized force fields for membrane environments

    • Enhanced sampling techniques for rare events

    • Microsecond to millisecond simulations

    • Quantum mechanics/molecular mechanics hybrid approaches

  • AI/ML Applications:

    • AlphaFold2 and RoseTTAFold for structure prediction

    • Deep learning for functional annotation

    • Automated image processing in cryo-EM

    • Virtual screening for ligand discovery

These technological advances collectively enhance our ability to study challenging membrane proteins like nuoK, providing unprecedented insights into their structure, function, and dynamics in near-native environments.

What are promising future research directions for nuoK and related respiratory proteins?

The study of nuoK and related respiratory proteins presents several promising future research directions:

• Systems Biology Integration:

  • Multi-omics approaches linking respiratory function to global metabolic networks

  • Quantitative models of respiratory chain dynamics under varying conditions

  • Integration of protein-level data with transcriptomics and metabolomics

  • Network analysis of respiratory complex assembly and regulation

• Medical and Biotechnological Applications:

  • Development of novel antimicrobials targeting nuoK and related subunits

  • Engineering of respiratory complexes for improved bioenergetic efficiency

  • Creation of biosensors based on respiratory components

  • Design of minimal respiratory systems for synthetic biology applications

• Advanced Structure-Function Investigations:

  • Time-resolved structural studies capturing conformational changes

  • Investigation of proton translocation mechanisms at atomic resolution

  • Mapping of quinone binding sites and electron transfer pathways

  • Characterization of supercomplexes involving NADH-quinone oxidoreductase

• Comparative Biology Approaches:

  • Evolutionary analysis across diverse bacterial species

  • Adaptation of respiratory complexes to extreme environments

  • Host-pathogen co-evolution of respiratory systems

  • Cross-species functional complementation studies

• Technological Development:

  • CRISPR-based high-throughput mutagenesis of respiratory complex genes

  • Development of novel membrane mimetics for functional studies

  • Advanced imaging techniques for visualizing complexes in native membranes

  • Computational methods for predicting assembly pathways and dynamics

These research directions promise to expand our understanding of bacterial respiratory complexes, with implications for fundamental science, antimicrobial development, and biotechnological applications.

How can research on E. coli nuoK inform our understanding of mitochondrial complex I disorders?

Research on E. coli nuoK provides valuable insights for understanding mitochondrial complex I disorders through evolutionary and functional parallels:

• Structural Conservation Relevance:

  • Bacterial nuoK is homologous to the mitochondrial ND4L subunit

  • Both proteins share:

    • Key transmembrane topology features

    • Functionally critical conserved residues

    • Roles in proton translocation

    • Positions within the membrane arm of complex I

• Disease Mutation Modeling:

  • Bacterial systems offer advantages for studying disease-associated mutations:

    • Faster generation time and simpler genetic manipulation

    • Ability to isolate effects in a less complex system

    • Higher protein yields for biochemical and structural studies

    • Complementation assays to validate mutation impacts

• Mechanistic Insights:

  • E. coli studies contribute to understanding:

    • Fundamental proton pumping mechanisms

    • Assembly pathways conserved between bacteria and mitochondria

    • Electron transfer coupling to proton translocation

    • Inhibitor binding sites relevant to drug development

• Translational Applications:

  • Bacterial research facilitates:

    • High-throughput screening for therapeutic compounds

    • Validation of computational predictions about mutation effects

    • Development of assays applicable to clinical samples

    • Understanding of secondary compensatory mechanisms