Recombinant Escherichia coli O9:H4 Nickel/cobalt efflux system rcnA (rcnA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
rcnA; EcHS_A2242; Nickel/cobalt efflux system RcnA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
rcnA
Target Protein Sequence
MTEFTTLLQQGNAWFFIPSVILLGALHGLEPGHSKTMMAAFIIAIKGTIKQAVMLGLAAT ISHTAVVWLIAFGGMVISKRFTAQSAEPWLQLISAVIIISTAFWMFWRTWRGERNWLENM HGHDYEHHHHDHEHHHDHGHHHHHEHGEYQDAHARAHANDIKRRFDGREVTNWQILLFGL TGGLIPCPAAITVLLICIQLKALTLGATLVVSFSIGLALTLVTVGVGAAISVQQVAKRWS GFNTLAKRAPYFSSLLIGLVGVYMGVHGFMGIMR
Uniprot No.

Target Background

Function
Nickel and cobalt efflux system.
Database Links
Protein Families
NiCoT transporter (TC 2.A.52) family, RcnA subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the rcnA gene and what function does it serve in E. coli?

The rcnA gene encodes a membrane-bound polypeptide that confers increased nickel and cobalt resistance in Escherichia coli. It functions as an efflux system, actively transporting nickel and cobalt ions out of the bacterial cell . Research has demonstrated that cells with mutations in rcnA exhibit increased accumulation of nickel inside the cell, whereas cells overexpressing rcnA from multicopy plasmids display reduced intracellular nickel content .

The rcnA gene is specifically induced by nickel or cobalt but not by other metals such as cadmium, zinc, or copper, suggesting a specialized role in nickel and cobalt homeostasis. This selectivity distinguishes it from other bacterial metal resistance systems that often have broader specificity profiles.

How is rcnA expression regulated in E. coli?

The expression of rcnA is controlled by the transcriptional repressor RcnR (formerly YohL). Nickel and cobalt-dependent regulation of rcnA expression requires RcnR, which binds directly to the rcnA promoter DNA fragment . This interaction is inhibited by nickel and cobalt ions, allowing for expression of rcnA when these metals are present at elevated levels.

Under nickel-limiting conditions, deletion of rcnA increases NikR activity in vivo . NikR is another regulatory protein involved in nickel homeostasis, primarily controlling the NikABCDE nickel transporter. The deletion of rcnR results in constitutive rcnA expression and a corresponding decrease in NikR activity, highlighting the interconnected nature of these regulatory systems . This cross-regulation ensures balanced nickel uptake and efflux, maintaining optimal intracellular nickel concentrations.

How can I create a recombinant strain expressing rcnA?

Creating a recombinant strain expressing rcnA can be accomplished through several methodologies:

Plasmid-Based Expression:

  • Amplify the rcnA gene using PCR with primers containing appropriate restriction sites

  • Clone the amplified gene into an expression vector (e.g., pET series for T7 promoter-based expression)

  • Transform the construct into an appropriate E. coli strain

  • Induce expression using IPTG or other suitable inducers

Chromosomal Integration:
For stable expression without antibiotic selection, chromosomal integration using recombineering is effective:

  • Use a defective λ prophage system that supplies recombination functions

  • Design linear DNA containing rcnA flanked by homology regions targeting the desired integration site

  • Induce recombination functions by shifting cultures to 42°C for 15 minutes

  • Electroporate the linear DNA into the cells

  • Select recombinants using appropriate markers

This approach has demonstrated high efficiency, as shown in the table below:

Target Site42°C Induction (min)Recombinants per Electroporation
galK0<1
galK152.5 × 10⁴
cIII kil gam0<1
cIII kil gam155.0 × 10⁴

The recombination system does not require host RecA function and depends primarily on Exo, Beta, and Gam functions expressed from the defective λ prophage .

What methods can optimize rcnA expression in recombinant systems?

Optimizing rcnA expression requires addressing several factors that affect membrane protein production:

N-terminal Sequence Modification:
The nucleotides immediately following the start codon significantly influence protein expression levels. A directed evolution approach can be implemented by:

  • Creating DNA libraries with diverse N-terminal coding sequences

  • Fusing GFP to the C-terminus of rcnA as a reporter

  • Using fluorescence-activated cell sorting (FACS) to select high-expressing variants

  • Sequence analysis of selected clones to identify beneficial sequence modifications

This approach has yielded up to 30-fold increases in soluble recombinant protein production for various constructs .

Expression Conditions Optimization:

  • Temperature: Lower temperatures (16-25°C) often improve membrane protein folding

  • Induction: Test various inducer concentrations and induction times

  • Media composition: Rich media (TB) vs. minimal media effects on expression

  • Strain selection: Specialized strains like C41/C43 designed for membrane protein expression

Fusion Tags and Solubility Enhancers:

  • N-terminal or C-terminal His-tags for detection and purification

  • Solubility-enhancing partners such as MBP, SUMO, or TrxA

  • Signal sequences directing proper membrane insertion

Each optimization strategy should be empirically tested for rcnA, as membrane protein expression requirements are often construct-specific.

How can I measure rcnA-mediated metal resistance in experimental systems?

Several complementary assays can quantify rcnA-mediated metal resistance:

Growth-Based Assays:

  • Minimum Inhibitory Concentration (MIC) determination:

    • Prepare serial dilutions of nickel/cobalt in appropriate media

    • Compare growth inhibition between wild-type, rcnA deletion, and rcnA overexpression strains

    • Identify the lowest concentration that prevents visible growth

  • Growth curve analysis:

    • Monitor bacterial growth in liquid media with varying metal concentrations

    • Compare lag times, growth rates, and maximum cell densities

    • Quantify resistance through area under curve (AUC) measurements

Metal Accumulation Assays:

  • Intracellular metal quantification:

    • Expose cells to defined nickel/cobalt concentrations

    • Wash cells thoroughly to remove extracellular metals

    • Lyse cells and measure metal content using ICP-MS or atomic absorption spectroscopy

    • Compare accumulation between strains with different rcnA expression levels

Molecular and Biochemical Assays:

  • rcnA expression monitoring:

    • Use reporter fusions (rcnA promoter driving GFP or lacZ)

    • Measure induction in response to metal exposure

    • Western blotting with anti-rcnA antibodies to quantify protein levels

  • In vitro transport assays:

    • Reconstitute purified rcnA into proteoliposomes

    • Measure metal transport using radioisotopes or metal-sensitive fluorescent dyes

    • Determine kinetic parameters (Km, Vmax) for different metals

These methods provide comprehensive characterization of rcnA function from physiological, biochemical, and molecular perspectives.

How does rcnA interact with other metal homeostasis systems in E. coli?

The rcnA efflux system operates within a complex network of metal homeostasis mechanisms in E. coli:

Interaction with Nickel Import Systems:
The rcnA efflux system functionally interacts with the NikABCDE nickel uptake system. Under nickel-limiting conditions, deletion of rcnA increases NikR activity in vivo . NikR is the transcriptional repressor that controls expression of the NikABCDE transporter. This regulatory connection ensures balanced nickel uptake and efflux.

RcnR-RcnA Regulatory System:
The rcnA gene is under the control of RcnR, a metal-responsive transcriptional repressor. RcnR binds directly to the rcnA promoter, and this interaction is inhibited specifically by nickel and cobalt ions . This allows for induction of rcnA expression only when these metals are present at elevated levels, providing a targeted response to specific metal stress.

Potential Interactions with Other Metal Transport Systems:
While rcnA is specifically induced by nickel and cobalt, E. coli possesses numerous other metal transport systems, including:

  • CopA (copper export)

  • ZntA (zinc/cadmium/lead export)

  • FeoB (iron import)

Research into potential cross-regulation and functional interactions between these systems would provide insights into how bacteria coordinate responses to multiple metals simultaneously.

What structural features determine rcnA's metal specificity?

The specificity of rcnA for nickel and cobalt is likely determined by several structural features:

Histidine-Rich Regions:
The E. coli rcnA protein contains a distinctive histidine-rich region (HEHDHEHHHHDHEDHHDHGHHHHHEH) . Histidine residues are well-known to coordinate nickel and cobalt ions in proteins, suggesting a direct role in metal binding and transport. Mutagenesis studies targeting these histidine residues could confirm their role in metal specificity.

Transmembrane Domain Architecture:
The arrangement and properties of the transmembrane domains create a transport pathway through which metals are moved across the membrane. The specific amino acid composition of these domains likely contributes to metal selectivity by creating an environment favorable for nickel and cobalt coordination but not for other metals.

Comparative Analysis Insights:
Comparison with other metal transport systems reveals that nickel/cobalt transporters often have distinct structural features compared to transporters for other metals. For example, the rcnA system differs structurally from:

  • CzcCBA (cobalt-zinc-cadmium) three-component system

  • CnrCBA (cobalt-nickel resistance) system

  • NccCBA (nickel-cobalt-cadmium resistance) system

Structural biology approaches, including X-ray crystallography or cryo-electron microscopy, would provide definitive insights into the metal-binding sites and transport mechanism of rcnA.

How can genetic engineering enhance rcnA-mediated metal resistance?

Several genetic engineering strategies can potentially enhance rcnA-mediated metal resistance:

Directed Evolution Approaches:

  • Random mutagenesis via error-prone PCR to generate rcnA variants

  • DNA shuffling with homologous transporters from metal-resistant organisms

  • FACS-based screening of libraries using metal-responsive fluorescent reporters

  • Selection on increasing metal concentrations to identify highly resistant variants

Rational Design Strategies:

  • Addition of metal-binding histidine clusters at strategic positions

  • Modification of transmembrane domains to enhance transport efficiency

  • Engineering of substrate binding sites based on structural insights

  • Construction of chimeric transporters combining domains from different metal efflux systems

Expression Enhancement:

  • Promoter engineering to increase expression or alter regulation

  • Optimization of N-terminal sequences as demonstrated in FACS-based approaches

  • Codon optimization for improved translation efficiency

  • Co-expression with chaperones to enhance proper folding and membrane insertion

System-Level Engineering:

  • Integration of rcnA with other resistance mechanisms for synergistic effects

  • Metabolic engineering to increase energy availability for active transport

  • Cell surface modification to reduce metal entry into the cell

  • Co-expression of metal-binding proteins to sequester metals internally

These approaches could generate enhanced variants of rcnA with improved metal efflux capabilities, potentially useful for bioremediation applications or as selectable markers in biotechnology.

What environmental factors influence rcnA function?

Several environmental factors can significantly affect rcnA expression and function:

pH Effects:
Metal solubility and bioavailability vary with pH, potentially affecting:

  • Metal uptake rates and consequently the demand for efflux

  • Proton gradients that may drive rcnA-mediated transport

  • Protein stability and conformation in the membrane

  • Competitive binding between protons and metal ions at binding sites

Temperature Influences:
Temperature variations can impact:

  • Membrane fluidity, affecting transporter dynamics

  • Protein folding and stability of the rcnA protein

  • Expression levels through temperature-dependent regulatory mechanisms

  • Metabolic activity providing energy for active transport

Oxygen Availability:
Aerobic versus anaerobic conditions affect:

Nutrient Status:
The nutritional environment influences:

Experimental approaches to study these effects include transcriptional analysis, protein level quantification, and transport assays under controlled environmental conditions, providing insights into how bacteria adapt metal homeostasis to changing environments.

What are effective methods for purifying recombinant rcnA protein?

Purification of recombinant rcnA presents challenges due to its membrane protein nature. The following strategies can be employed:

Expression Optimization:

  • Use E. coli strains specialized for membrane protein expression (C41/C43)

  • Express with N-terminal or C-terminal His-tags for affinity purification

  • Consider fusion partners that improve solubility and expression

  • Optimize induction conditions (temperature, inducer concentration, time)

Membrane Protein Extraction:

  • Carefully select detergents for solubilization:

    • n-Dodecyl β-D-maltoside (DDM)

    • n-Octyl β-D-glucopyranoside (OG)

    • Lauryldimethylamine oxide (LDAO)

  • Optimize detergent:protein ratios through systematic screening

  • Consider alternative solubilization approaches like styrene maleic acid lipid particles (SMALPs)

Purification Strategy:

  • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Ion exchange chromatography as an additional purification step if needed

  • Affinity chromatography using immobilized metals (nickel/cobalt) as pseudosubstrates

Quality Assessment:

  • SDS-PAGE and Western blotting to verify identity and purity

  • Mass spectrometry to confirm protein integrity

  • Dynamic light scattering to assess homogeneity

  • Functional assays in proteoliposomes to verify activity

A typical workflow yields 1-5 mg of purified protein per liter of culture, sufficient for biochemical and structural studies.

How can I design experiments to study rcnA transport kinetics?

Understanding the kinetics of rcnA-mediated metal transport requires specialized experimental approaches:

In Vitro Reconstitution Systems:

  • Reconstitute purified rcnA into proteoliposomes:

    • Prepare liposomes from E. coli lipids

    • Add purified rcnA protein during liposome formation

    • Remove detergent by dialysis or adsorption

  • Create metal gradients across the membrane

  • Measure metal transport using:

    • Radioactive metal isotopes (⁶³Ni, ⁶⁰Co)

    • Metal-sensitive fluorescent probes

    • ICP-MS analysis of vesicle content

Kinetic Parameter Determination:

  • Measure initial transport rates at varying metal concentrations

  • Generate Michaelis-Menten plots to determine:

    • Km (apparent affinity for substrate)

    • Vmax (maximum transport rate)

    • Competitive inhibition patterns with other metals

Energetic Requirements:

  • Investigate dependence on membrane potential:

    • Use ionophores to dissipate proton gradients

    • Manipulate membrane potential with valinomycin/K⁺

  • Assess ATP dependence:

    • Deplete ATP using metabolic inhibitors

    • Compare transport rates under various energetic conditions

Whole-Cell Transport Studies:

  • Compare metal uptake/efflux in:

    • Wild-type cells

    • rcnA deletion mutants

    • rcnA overexpression strains

  • Quantify intracellular metal content over time

  • Correlate transport rates with expression levels

These approaches provide complementary data on transport mechanisms, substrate specificity, and factors affecting rcnA activity.

How can I analyze rcnA expression data for robust interpretation?

Proper analysis of rcnA expression data requires careful experimental design and statistical approaches:

Experimental Controls:

  • Include appropriate genetic controls:

    • Wild-type strain

    • rcnA deletion mutant

    • rcnA overexpression strain

    • Empty vector control

  • Technical controls:

    • Reference genes for normalization in qPCR (gyrA, rpoD)

    • Loading controls for Western blots

    • Metal-free conditions as baseline

Quantitative Analysis Methods:

  • For transcriptional analysis:

    • qRT-PCR with validated primers

    • RNA-Seq for genome-wide context

    • Normalization to stable reference genes

  • For protein level analysis:

    • Western blotting with anti-rcnA antibodies

    • Densitometry for semi-quantitative analysis

    • Mass spectrometry for absolute quantification

Statistical Approaches:

  • Biological replicates (minimum n=3) for statistical power

  • Appropriate statistical tests:

    • ANOVA for multiple condition comparisons

    • t-tests for paired comparisons

    • Non-parametric tests for non-normally distributed data

  • Multiple testing correction for genome-wide studies

Data Visualization:

These analytical approaches ensure robust, reproducible interpretation of rcnA expression data across different experimental conditions.

How can I address poor growth of E. coli expressing recombinant rcnA?

Poor growth of recombinant strains expressing rcnA may result from several factors:

Toxicity Management:

  • Use tightly controlled expression systems:

    • pBAD vectors with glucose repression

    • Tet-inducible systems with reduced leakiness

  • Reduce expression levels:

    • Lower inducer concentrations

    • Shorter induction times

    • Weaker promoters

Metabolic Burden Reduction:

  • Optimize media composition:

    • Supplement with amino acids to reduce biosynthetic demands

    • Consider complex media for improved growth

  • Lower copy number vectors:

    • Switch from high-copy (pUC-based) to medium (pBR322) or low-copy (p15A) vectors

  • Optimize temperature:

    • Grow at lower temperatures (25-30°C)

    • Use heat-inducible systems for controlled expression

Metal Homeostasis Disruption:

  • Add low levels of nickel/cobalt to media:

    • Provides substrates for the transporter

    • May prevent depletion of essential metals

  • Supplement with metal mixtures:

    • Ensure availability of all required metals

    • Prevents secondary deficiencies

Strain Selection:

  • Test alternative E. coli strains:

    • BL21(DE3) for reduced protease activity

    • Origami for improved disulfide bond formation

    • C41/C43 for membrane protein tolerance

These strategies can significantly improve growth characteristics while maintaining adequate rcnA expression levels for experimental purposes.

How can I resolve inconsistent metal resistance phenotypes in rcnA-expressing strains?

Inconsistent phenotypes when studying rcnA-mediated metal resistance can be addressed through systematic troubleshooting:

Genetic Stability Verification:

  • Sequence verify the rcnA construct:

    • Check for mutations in the coding sequence

    • Verify promoter and regulatory regions

  • Assess plasmid stability:

    • Maintain selection pressure during growth

    • Check for plasmid loss in overnight cultures

    • Consider chromosomal integration for stability

Expression Level Variability:

  • Quantify actual rcnA expression:

    • Western blotting with anti-rcnA antibodies

    • qRT-PCR for transcript levels

  • Standardize induction protocols:

    • Precise OD₆₀₀ at induction time

    • Consistent inducer concentrations

    • Controlled temperature conditions

Media and Environmental Considerations:

  • Standardize media composition:

    • Define exact metal content in media

    • Control for metal contaminants in water and reagents

    • Use the same batch of media components

  • Maintain consistent growth conditions:

    • Temperature fluctuations

    • Aeration levels

    • pH stability

Assay Standardization:

  • Develop robust phenotypic assays:

    • Standard inoculum density

    • Fresh overnight cultures

    • Consistent incubation times

  • Include appropriate controls in each experiment:

    • Wild-type strain

    • rcnA deletion mutant

    • Known metal-resistant strain as positive control

These approaches can significantly reduce variability and improve reproducibility in metal resistance phenotyping.

What controls are essential when studying recombinant rcnA function?

Robust experimental design for rcnA studies requires comprehensive controls:

Genetic Controls:

  • Wild-type strain (baseline phenotype)

  • rcnA deletion mutant (loss-of-function)

  • Complemented rcnA deletion (restoration of function)

  • Site-directed mutants (e.g., histidine→alanine substitutions in metal-binding regions)

  • Empty vector control (for plasmid-based expression)

Expression Controls:

  • Verification of protein expression:

    • Western blotting with anti-rcnA antibodies

    • Tagged constructs for easier detection

  • Localization confirmation:

    • Membrane fraction analysis

    • Fluorescently tagged versions for localization

Metal Specificity Controls:

  • Multiple metal ions:

    • Nickel and cobalt (primary substrates)

    • Zinc, copper, iron (should not be affected)

  • Range of metal concentrations:

    • Sub-inhibitory to toxic

    • Dose-response curves

  • Metal chelators:

    • EDTA as general chelator

    • Metal-specific chelators

Physiological Controls:

  • Growth phase standardization:

    • Exponential phase cultures

    • Standardized OD₆₀₀ values

  • Consistent environmental conditions:

    • Temperature

    • Aeration

    • pH

    • Media composition

Methodological Controls:

  • Technical replicates (minimum triplicate)

  • Biological replicates (independent cultures)

  • Method-specific controls:

    • Standard curves for metal quantification

    • No-template controls for PCR

    • Antibody specificity controls for Western blots

Implementing these controls ensures that observed phenotypes are specifically attributable to rcnA function rather than experimental artifacts or secondary effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.