Recombinant Escherichia coli O9:H4 p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
aaeA; EcHS_A3430; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQVLFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPVDGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeAB efflux system and what is its primary function in Escherichia coli?

The AaeAB efflux system is a specialized membrane transport system in Escherichia coli that functions primarily to export aromatic carboxylic acids from the bacterial cell. This system consists of several key components encoded by genes that were originally designated as yhcS, yhcR, yhcQ, and yhcP, but have been renamed to aaeR, aaeX, aaeA, and aaeB, respectively, to reflect their role in aromatic carboxylic acid efflux .

The AaeA protein (formerly YhcQ) functions as a membrane fusion protein, while AaeB (formerly YhcP) serves as the actual efflux protein. Together, they form a functional pump complex that transports specific aromatic carboxylic acids across the cell membrane. This system is highly regulated and appears to function as a "metabolic relief valve" to alleviate toxic effects that might arise from imbalanced metabolism within the bacterial cell .

What evidence demonstrates that AaeA is involved in p-hydroxybenzoic acid efflux?

Multiple experimental approaches have provided strong evidence for AaeA's role in p-hydroxybenzoic acid (pHBA) efflux:

  • Gene expression studies: When E. coli is exposed to pHBA, microarray analysis reveals significant upregulation of yhcQ (aaeA), with expression increasing 22-fold after 60 minutes of exposure to 25 mM pHBA .

  • Mutant phenotype analysis: Strains with mutations in yhcP (aaeB) show hypersensitivity to pHBA, clearly demonstrating the efflux function of this gene. Similarly, mutants in yhcS (aaeR) also display hypersensitivity to pHBA .

  • Complementation studies: Expression of yhcQ (aaeA) and yhcP (aaeB) together is both necessary and sufficient to suppress the pHBA hypersensitivity of yhcS mutants, confirming their functional role in the efflux system .

  • Substrate specificity testing: Experimental testing of hundreds of diverse compounds identified only a few aromatic carboxylic acids as substrates for the YhcQP (AaeAB) efflux pump, reinforcing its specialized role in handling these specific compounds .

What experimental approaches are most effective for studying AaeA function in different E. coli serotypes?

For comprehensive functional characterization of AaeA across E. coli serotypes, researchers should employ a multi-faceted experimental approach:

1. Genetic manipulation techniques:

  • Construction of gene knockout mutants using P1 phage transduction or CRISPR-Cas9 systems to create ΔaaeA strains

  • Complementation studies with plasmid-borne aaeA under both native and inducible promoters

  • Site-directed mutagenesis to identify critical residues for function

  • Chromosomal gene tagging for localization studies

2. Expression analysis methods:

  • qRT-PCR to quantify aaeA expression under different conditions

  • Transcriptome analysis using RNA-seq to identify co-regulated genes

  • Reporter gene fusions (e.g., aaeA-gfp) to monitor expression patterns

  • Western blotting with anti-AaeA antibodies to track protein levels

3. Functional assays:

  • Minimum inhibitory concentration (MIC) determinations for different aromatic compounds

  • Direct measurement of substrate export using radiolabeled compounds

  • Fluorescent substrate accumulation assays

  • Growth kinetics in presence of efflux pump substrates

  • Competition assays between different E. coli serotypes

4. Structural biology approaches:

  • Protein purification and reconstitution in liposomes

  • Protein crystallography or cryo-EM to determine AaeA structure

  • Molecular dynamics simulations to model substrate interactions

When comparing AaeA function across serotypes like O9:H4 and others, researchers must account for genetic background differences by performing complementary experiments in isogenic backgrounds when possible .

How does the genetic organization of the aae operon influence the expression and function of AaeA, and what methods can be used to study this relationship?

The aae operon has a complex genetic organization that significantly impacts AaeA expression and function. Understanding this relationship requires specialized experimental approaches:

Genetic Organization and Regulatory Features:

  • The aae operon consists of aaeR (transcriptional regulator), aaeX (unknown function), aaeA (membrane fusion protein), and aaeB (efflux protein)

  • aaeR is divergently transcribed from aaeXAB, suggesting it serves as a regulator

  • aaeR encodes a LysR-type transcriptional regulator that controls expression of the aaeXAB genes

Methodological Approaches to Study this Relationship:

  • Promoter mapping and analysis:

    • 5' RACE to identify transcription start sites

    • Reporter gene fusions to characterize promoter activity

    • In vitro DNA-binding assays (EMSAs) to identify AaeR binding sites

    • DNase I footprinting to precisely map regulatory regions

  • Regulatory protein interactions:

    • Chromatin immunoprecipitation (ChIP) to identify AaeR binding in vivo

    • Bacterial two-hybrid assays to detect protein-protein interactions

    • Pull-down assays with purified AaeR to identify interacting proteins

    • Mass spectrometry to identify protein complexes

  • Transcriptional response analysis:

    • Microarray or RNA-seq under various inducing conditions

    • Time-course experiments to track expression dynamics

    • Single-cell gene expression analysis to identify heterogeneity

  • Mutational analysis:

    • Construction of deletion mutants of individual genes

    • Site-directed mutagenesis of regulatory elements

    • Scanning mutagenesis of the intergenic region between aaeR and aaeX

    • Creation of chimeric regulators to identify functional domains

Based on published research, treatment of E. coli with p-hydroxybenzoic acid results in upregulation of the entire aaeXAB operon, with fold changes of 10, 22, and 12 for aaeX, aaeA, and aaeB respectively after exposure to 25 mM pHBA for 60 minutes . This coordinated response indicates tight regulation of the entire system.

What substrate specificity patterns have been identified for the AaeAB efflux system, and how can researchers characterize novel substrates?

The AaeAB efflux system displays highly selective substrate specificity, primarily targeting a narrow range of aromatic carboxylic acids. Research has shown that only a few aromatic carboxylic acids from hundreds of diverse compounds tested were identified as substrates for this pump .

Known substrate specificity patterns:

  • p-Hydroxybenzoic acid (pHBA) is a primary substrate and inducer

  • Several other aromatic carboxylic acid compounds serve as inducers of aaeXAB expression

  • The system appears selective for compounds with specific structural features

Methodological approach for characterizing novel substrates:

  • Primary screening methods:

    • Growth inhibition assays comparing wild-type and ΔaaeA/ΔaaeB strains

    • Disk diffusion assays with candidate compounds

    • Minimum inhibitory concentration (MIC) determination

    • Checkerboard assays with efflux pump inhibitors

  • Direct transport measurement:

    • Radiolabeled substrate accumulation assays

    • HPLC-based detection of compound export

    • Fluorescent substrate analogs with spectrofluorimetric detection

    • LC-MS/MS for quantitative measurement of substrate levels

  • Expression response analysis:

    • qRT-PCR to measure aaeXAB induction by potential substrates

    • Reporter gene constructs (aaeA-lacZ or aaeA-lux) for high-throughput screening

    • Transcriptomics to identify global response patterns

    • Proteomics to measure AaeA/AaeB protein levels after exposure

  • Structural characterization:

    • Molecular docking simulations with candidate compounds

    • Site-directed mutagenesis of predicted binding site residues

    • Photoaffinity labeling with modified substrates

    • Surface plasmon resonance or isothermal titration calorimetry for binding affinity

Table 1: Experimentally Determined AaeAB Substrates and Their Properties

CompoundStructure TypeRoleExperimental EvidenceReference
p-Hydroxybenzoic acidAromatic carboxylic acidSubstrate and inducerHypersensitivity in ΔaaeB mutants; gene induction
Other aromatic carboxylic acids*Aromatic carboxylic acidSubstratesDifferential sensitivity in mutants

*Specific compounds not fully detailed in the available search results

How can recombinant AaeA protein be effectively expressed, purified, and functionally characterized in laboratory settings?

Producing functional recombinant AaeA protein requires specialized techniques due to its membrane-associated nature. The following comprehensive protocol outlines the optimal approach:

Expression System Selection:

  • E. coli BL21(DE3) or C43(DE3) strains are recommended for membrane protein expression

  • Expression vectors with inducible promoters (T7, tac) and fusion tags (His6, MBP, GST) optimize yield and purification

  • Consider codon optimization for the aaeA gene sequence when expressing in heterologous systems

Protein Expression Protocol:

  • Clone the aaeA gene (310 amino acids) into an expression vector with an appropriate tag

  • Transform the construct into the selected expression strain

  • Grow cells at 37°C until OD600 reaches 0.6-0.8

  • Reduce temperature to 18-20°C before induction

  • Induce with a low concentration of IPTG (0.1-0.5 mM) or appropriate inducer

  • Continue expression for 16-20 hours at reduced temperature

  • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

Membrane Protein Purification Strategy:

  • Resuspend cell pellet in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Disrupt cells using sonication or cell disruption systems

  • Perform low-speed centrifugation (10,000 × g, 20 min, 4°C) to remove cell debris

  • Ultracentrifuge the supernatant (100,000 × g, 1 hour, 4°C) to isolate membrane fractions

  • Solubilize membrane proteins using mild detergents (DDM, LDAO, or Triton X-100)

  • Perform affinity chromatography using the fusion tag

  • Apply size exclusion chromatography for final purification

  • Store purified protein in buffer containing 50% glycerol at -20°C

Functional Characterization Methods:

  • Reconstitution into proteoliposomes:

    • Mix purified AaeA with lipids and detergent

    • Remove detergent using Bio-Beads or dialysis

    • Verify incorporation using freeze-fracture electron microscopy

  • Substrate binding assays:

    • Isothermal titration calorimetry with potential substrates

    • Fluorescence-based ligand binding assays

    • Surface plasmon resonance with immobilized protein

  • Functional assays:

    • Transport assays using radioisotope-labeled substrates

    • Membrane potential measurements in proteoliposomes

    • Co-reconstitution with AaeB to measure complete system function

  • Structural characterization:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to identify domain boundaries

    • Crystallization trials or cryo-EM analysis

Quality Control Checkpoints:

  • SDS-PAGE and Western blotting to confirm expression and purity

  • Mass spectrometry to verify protein identity

  • Dynamic light scattering to assess protein homogeneity

  • Thermal shift assays to evaluate protein stability

What role does the AaeA protein play in bacterial resistance to antimicrobial compounds, and how can this be experimentally investigated?

The AaeA protein, as a component of the AaeAB efflux system, potentially contributes to bacterial resistance against certain antimicrobial compounds, particularly those with aromatic carboxylic acid structures. This relationship can be systematically investigated using the following experimental approaches:

Fundamental Resistance Mechanisms:

  • AaeA forms part of a specialized efflux system that can export toxic compounds

  • The pump has substrate specificity for aromatic carboxylic acids

  • It may provide intrinsic resistance against naturally occurring antimicrobial compounds

  • Cross-resistance with clinical antibiotics containing aromatic carboxylic acid groups is possible

Experimental Investigation Methods:

  • Antimicrobial susceptibility testing:

    • Determine MICs for various antimicrobials in wild-type and ΔaaeA strains

    • Perform time-kill assays to assess killing kinetics

    • Conduct population analysis profiling to identify resistant subpopulations

    • Use checkerboard assays to identify synergy with efflux pump inhibitors

  • Gene expression response:

    • Measure aaeA expression in response to subinhibitory concentrations of antimicrobials

    • Perform RNA-seq or microarray analysis to identify co-regulated genes

    • Use reporter constructs (aaeA-gfp) to visualize expression patterns

    • Apply qRT-PCR to quantify expression changes

  • Direct transport assays:

    • Measure accumulation of fluorescent antimicrobial surrogates

    • Conduct isotope-labeled drug accumulation experiments

    • Use LC-MS/MS to quantify antimicrobial export rates

    • Employ membrane vesicle-based transport assays

  • Genetic approaches:

    • Create strains overexpressing aaeA to assess resistance phenotypes

    • Generate aaeA mutants with altered specificity through directed evolution

    • Construct chimeric efflux pumps to identify substrate specificity determinants

    • Perform genome-wide screens for genetic interactions with aaeA

Table 2: Experimental Design for Investigating AaeA-Mediated Resistance

Experimental ApproachKey MethodsExpected OutcomesPotential Challenges
Comparative susceptibilityMIC testing, disk diffusionIdentify compounds affected by AaeASmall differences may be difficult to detect
Transport kineticsRadioisotope-labeled compoundsDirect measurement of efflux ratesTechnical complexity with membrane proteins
Expression regulationqRT-PCR, reporter constructsUnderstand regulatory mechanismsDistinguishing direct from indirect effects
Structure-functionSite-directed mutagenesisIdentify critical amino acidsEnsuring proper membrane insertion
In vivo relevanceAnimal infection modelsDetermine clinical significanceTranslation from in vitro to in vivo

How do the genetic and functional characteristics of AaeA differ between pathogenic and non-pathogenic E. coli strains?

The AaeA protein may exhibit important variations between pathogenic and non-pathogenic E. coli strains, potentially contributing to differences in virulence, colonization ability, and stress response. This comparison requires systematic investigation:

Known Differences Between E. coli Strains:

  • E. coli O9 strains have been found in diverse serotypes with varying pathogenic potential

  • Pathogenic strains may contain combinations of diarrheagenic E. coli (DEC) genes alongside commensal genetic backgrounds

  • E. coli O9 strains have been identified in both commensal phylogenetic groups A and B1

Methodological Approach for Comparative Analysis:

  • Genomic and sequence analysis:

    • Whole genome sequencing of multiple pathogenic and non-pathogenic strains

    • Comparative genomics to identify variations in aaeA and the aae operon

    • SNP analysis to detect point mutations in regulatory or coding regions

    • Phylogenetic analysis to track evolutionary changes

  • Expression pattern comparison:

    • Transcriptome analysis under identical conditions

    • qRT-PCR quantification of aaeA expression during infection models

    • Proteomics to measure AaeA protein levels

    • Reporter gene constructs to visualize expression patterns

  • Functional comparative assays:

    • Transport activity measurements using identical substrates

    • Stress response comparisons (pH, osmotic, oxidative stress)

    • Biofilm formation capacity assessment

    • Host cell adherence and invasion assays

  • In vivo relevance testing:

    • Colonization studies with wild-type and ΔaaeA mutants

    • Competition assays between pathogenic and non-pathogenic strains

    • Animal infection models to assess virulence contributions

    • Tissue culture systems to evaluate host-pathogen interactions

Table 3: Comparative Analysis of AaeA in Different E. coli Strains

AspectNon-pathogenic E. coliPotentially Pathogenic E. coli O9Significance
Phylogenetic groupsPrimarily A and B1 Found in both A and B1 groups Suggests independent acquisition of virulence factors
Genetic contextCore genome componentMay have additional virulence genes nearbyPotential for co-regulation with virulence factors
Expression regulationResponds to metabolic stressesMay respond to host environment signalsAdaptation to different ecological niches
Substrate specificityLimited to metabolic compoundsPotentially broader to include host-derived compoundsEnhanced survival in host environments

What are the potential applications of AaeA in biotechnology and synthetic biology, and how can its properties be optimized for these purposes?

The AaeA protein offers several innovative applications in biotechnology and synthetic biology, particularly for developing engineered organisms with enhanced chemical production or bioremediation capabilities:

Potential Biotechnological Applications:

  • Bioproduction of aromatic compounds:

    • Engineering efflux systems to export toxic intermediates during bioproduction

    • Creating feedback-resistant production strains for aromatic compounds

    • Developing biosensors for aromatic carboxylic acid detection

    • Improving industrial strain tolerance to aromatic compounds

  • Environmental bioremediation:

    • Designing bacteria with enhanced capacity to process aromatic pollutants

    • Creating biosensors for environmental monitoring of specific compounds

    • Developing biofilters with immobilized recombinant proteins

    • Engineering consortia with specialized efflux functions

  • Protein engineering platforms:

    • Using AaeA as a scaffold for developing novel substrate specificities

    • Creating chimeric transporters with expanded capabilities

    • Developing synthetic biological circuits responsive to aromatic compounds

    • Engineering membrane protein expression systems

Optimization Approaches:

  • Directed evolution strategies:

    • Error-prone PCR to generate AaeA variants

    • Screening under selective pressure for improved function

    • Continuous evolution systems with appropriate selection

    • DNA shuffling with related efflux proteins

  • Rational design methods:

    • Structure-guided mutagenesis of binding sites

    • Computational modeling to predict beneficial mutations

    • Domain swapping with other efflux pumps

    • Introduction of post-translational modification sites

  • Expression optimization:

    • Codon optimization for different host organisms

    • Promoter engineering for context-specific expression

    • Signal sequence modifications for improved membrane insertion

    • Co-expression with chaperones to enhance folding

  • System-level optimization:

    • Engineering of the entire aae operon for coordinated expression

    • Integration with metabolic pathways for specific applications

    • Development of synthetic regulatory circuits

    • Co-optimization with outer membrane components for complete efflux systems

The optimization of AaeA properties would require careful characterization of its structure-function relationships, which remain partially understood based on current research . The protein's role as part of a "metabolic relief valve" suggests it could be engineered to relieve toxic buildup of metabolic intermediates in synthetic pathways .

How does the AaeA protein interact with other components of bacterial efflux systems, and what techniques can be used to study these interactions?

The AaeA protein functions as part of a complex efflux system where protein-protein interactions are crucial for proper function. Understanding these interactions requires specialized approaches:

Key Interaction Partners:

  • AaeB (efflux protein) - forms the primary functional complex with AaeA

  • TolC (outer membrane channel) - likely required for complete efflux system function

  • AaeR (transcriptional regulator) - controls expression of the system

  • AaeX (unknown function protein) - co-expressed with AaeA and AaeB

Methodological Approaches to Study Interactions:

  • In vivo interaction studies:

    • Bacterial two-hybrid systems

    • Fluorescence resonance energy transfer (FRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Co-immunoprecipitation with tagged proteins

    • Chemical cross-linking followed by mass spectrometry

    • In vivo photo-crosslinking with unnatural amino acids

  • In vitro binding assays:

    • Surface plasmon resonance with purified components

    • Isothermal titration calorimetry

    • Microscale thermophoresis

    • Pull-down assays with purified proteins

    • Native gel electrophoresis to detect complexes

    • Size exclusion chromatography to analyze complex formation

  • Structural biology approaches:

    • X-ray crystallography of protein complexes

    • Cryo-electron microscopy of assembled systems

    • NMR spectroscopy for dynamic interaction studies

    • Hydrogen-deuterium exchange mass spectrometry

    • Single-particle tracking in reconstituted systems

    • Molecular dynamics simulations of complex assembly

  • Functional interaction analysis:

    • Genetic complementation studies

    • Suppressor mutation analysis

    • Dominant negative mutant effects

    • Synthetic genetic array analysis

    • Activity assays with reconstituted components

    • Site-directed mutagenesis of interaction interfaces

Research has demonstrated that expression of both aaeA and aaeB together is necessary and sufficient for suppression of pHBA hypersensitivity in aaeR mutants, indicating their functional interdependence . This suggests a direct physical interaction between AaeA and AaeB proteins to form a functional efflux complex.

What are the common challenges in working with recombinant AaeA protein, and how can researchers overcome these issues?

Working with recombinant AaeA presents several technical challenges due to its nature as a membrane fusion protein. The following comprehensive troubleshooting guide addresses these issues:

Challenge 1: Poor expression yields

  • Problem: Low protein production in expression systems

  • Solutions:

    • Optimize codon usage for the expression host

    • Test multiple expression strains (BL21, C41, C43, Rosetta)

    • Reduce expression temperature to 16-20°C

    • Use specialized media formulations (Terrific Broth, autoinduction)

    • Add membrane protein expression enhancers (betaine, sorbitol)

    • Test different induction conditions (IPTG concentration, timing)

    • Consider fusion partners that enhance folding (MBP, SUMO)

Challenge 2: Protein instability and aggregation

  • Problem: Aggregation during expression or purification

  • Solutions:

    • Screen multiple detergents for solubilization (DDM, LDAO, OG)

    • Include stabilizing agents (glycerol, specific lipids)

    • Optimize buffer conditions (pH, salt concentration)

    • Add reducing agents to prevent disulfide-mediated aggregation

    • Purify at 4°C throughout all steps

    • Consider using nanodiscs or amphipols for stabilization

    • Test additive screens to identify stabilizing compounds

Challenge 3: Poor membrane extraction

  • Problem: Inefficient extraction from membrane fractions

  • Solutions:

    • Optimize detergent:protein ratio during solubilization

    • Test different detergent concentrations and types

    • Extend solubilization time (4-16 hours)

    • Use sequential extraction with different detergents

    • Consider using stronger solubilization methods for initial extraction

    • Evaluate detergent exchange during purification

Challenge 4: Loss of functional activity

  • Problem: Purified protein lacks transport activity

  • Solutions:

    • Co-purify with AaeB to maintain the functional complex

    • Include specific lipids during purification

    • Test reconstitution in different lipid compositions

    • Optimize protein:lipid ratios during reconstitution

    • Verify proper orientation in proteoliposomes

    • Ensure removal of deleterious detergents before activity assays

    • Consider native purification approaches

Challenge 5: Specificity of functional assays

  • Problem: Difficulty demonstrating specific transport activity

  • Solutions:

    • Include appropriate controls (inactive mutants)

    • Use multiple assay formats for confirmation

    • Develop high-sensitivity detection methods for substrates

    • Account for background transport in assay design

    • Consider using inside-out membrane vesicles for direct assays

    • Perform competition studies with known substrates

Experimental Planning Table for AaeA Production:

StageKey Variables to OptimizeSuccess IndicatorsQuality Control
CloningConstruct design, tag positionSequence verificationRestriction analysis
ExpressionStrain, temperature, inducerVisible band on SDS-PAGEWestern blot
Membrane extractionDetergent type, concentrationProtein in soluble fractionSDS-PAGE analysis
PurificationBuffer conditions, column choiceSingle peak in SECPurity assessment
Functional reconstitutionLipid composition, protein ratioTransport activityNegative controls

How can researchers ensure reproducibility in experiments involving AaeA, particularly across different E. coli strains?

Ensuring reproducibility in experiments with AaeA across different E. coli strains requires rigorous standardization of procedures and careful consideration of strain-specific variables:

Sources of Variability:

  • Genetic background differences between E. coli strains

  • Expression level variations due to promoter context

  • Post-translational modifications affecting function

  • Growth condition influences on membrane composition

  • Regulatory network differences affecting AaeA expression

Standardization Strategies:

  • Strain characterization and documentation:

    • Complete genome sequencing of experimental strains

    • Verification of aaeA sequence integrity before experiments

    • Documentation of strain history and maintenance procedures

    • Creation of single-use glycerol stocks from verified colonies

    • Regular phenotypic testing to ensure strain stability

  • Expression system standardization:

    • Use of identical expression vectors across experiments

    • Quantitative measurement of expression levels

    • Implementation of inducible systems with titratable expression

    • Normalization of protein levels between experiments

    • Western blot quantification with standard curves

  • Growth condition control:

    • Precise media preparation with defined components

    • Standardized temperature, aeration, and pH conditions

    • Consistent growth phases for experiments

    • Detailed documentation of growth parameters

    • Use of bioreactors for tight environmental control

  • Functional assay standardization:

    • Development of standard operating procedures (SOPs)

    • Implementation of internal controls in each experiment

    • Inclusion of reference compounds with known effects

    • Statistical power analysis to determine sample sizes

    • Blinded analysis where possible

  • Data analysis and reporting:

    • Detailed methods sections with all parameters specified

    • Raw data preservation and sharing

    • Transparent statistical analysis procedures

    • Reporting of negative and unexpected results

    • Use of open science frameworks for data deposition

Experimental Validation Approach:

For cross-strain comparisons involving AaeA, implement a systematic validation protocol:

  • Establish baseline AaeA expression in each strain using qRT-PCR

  • Create isogenic strains with identical aaeA expression constructs

  • Verify protein production levels via Western blotting

  • Conduct parallel functional assays with identical substrates

  • Perform complementation tests using the same aaeA allele

  • Document strain-specific differences that persist despite standardization

This approach acknowledges that some E. coli serotypes may have inherent differences in their response to aromatic compounds and efflux pump function, which should be characterized rather than eliminated .

How does the AaeA efflux pump subunit compare to other bacterial efflux systems in terms of structure, function, and substrate specificity?

The AaeA efflux pump subunit represents a specialized component of bacterial transport machinery with distinct characteristics compared to other efflux systems:

Structural Comparison:

  • AaeA belongs to the membrane fusion protein (MFP) family , which typically functions as adaptors between inner membrane transporters and outer membrane channels

  • Unlike some MFPs that function with ABC transporters, AaeA works with the AaeB efflux protein

  • The system appears to be part of the Resistance-Nodulation-Division (RND) superfamily of transporters based on its components

  • AaeA's 310-amino acid sequence is typical for MFPs, which generally range from 300-500 amino acids

Functional Comparison:

Efflux SystemComponentsEnergy SourcePrimary SubstratesPhysiological Role
AaeABAaeA (MFP), AaeB (transporter), TolC*PMF**Aromatic carboxylic acids "Metabolic relief valve"
AcrAB-TolCAcrA (MFP), AcrB (RND), TolCPMFBroad spectrum (antibiotics, dyes, detergents)Multidrug resistance
EmrABEmrA (MFP), EmrB (MFS), TolCPMFHydrophobic compounds, uncouplersDrug resistance
MacABMacA (MFP), MacB (ABC), TolCATPMacrolides, peptide toxinsAntibiotic resistance

*TolC involvement inferred but not specifically demonstrated in search results
**PMF = Proton Motive Force (inferred based on system classification)

Substrate Specificity Comparison:

  • AaeAB shows highly selective specificity for aromatic carboxylic acids

  • This narrow substrate range contrasts with broadly-specific pumps like AcrAB-TolC

  • The system is specifically induced by p-hydroxybenzoic acid and related compounds

  • Unlike many multidrug resistance pumps, AaeAB appears to have evolved for specific metabolic functions rather than general xenobiotic export

Regulatory Comparison:

  • AaeAB is regulated by AaeR, a LysR-type transcriptional regulator

  • This direct local regulation differs from systems under global regulators (like MarA, SoxS)

  • Expression is specifically induced by substrate compounds

  • The system appears to have physiological rather than stress-response regulation

Evolutionary Context:

  • The specific role in aromatic carboxylic acid efflux suggests adaptation to particular ecological niches

  • The presence of similar systems across diverse bacteria indicates conserved metabolic requirements

  • The narrow substrate specificity suggests optimization for specific compounds rather than general protection

The AaeAB system's proposed role as a "metabolic relief valve" represents a specialized function compared to the broader protective roles of many other efflux systems, highlighting the diversity of transporter functions in bacterial physiology.

What insights can comparative genomics provide about the evolution and distribution of AaeA across bacterial species?

Comparative genomics offers valuable insights into the evolutionary history and distribution of AaeA across the bacterial kingdom:

Phylogenetic Distribution and Conservation:

  • The aaeA gene appears to be present in multiple Escherichia coli strains, including pathogenic variants

  • The gene originally designated as yhcQ before being renamed to aaeA

  • Different E. coli serotypes and phylogenetic groups contain this gene system

  • The AaeA protein sequence of 310 amino acids likely shows varying degrees of conservation across species

Genomic Context Analysis:

  • In E. coli, aaeA is found in an operon with aaeX and aaeB

  • The regulatory gene aaeR is divergently transcribed upstream of this operon

  • This genomic organization enables coordinated expression of the efflux system components

  • Conservation of this arrangement would suggest functional constraints on the system

Evolutionary Mechanisms:

  • Analysis of GC content and codon usage could reveal potential horizontal gene transfer events

  • Identification of mobile genetic elements near the aae operon might indicate mobilization

  • Comparison of evolutionary rates between core genes and aaeA could indicate selective pressures

  • Analysis of synonymous vs. non-synonymous substitutions would reveal functional constraints

Methodological Approach for Comparative Genomic Analysis:

  • Sequence homology analysis:

    • BLAST searches across bacterial genomes

    • Construction of phylogenetic trees using AaeA sequences

    • Analysis of conserved domains and motifs

    • Identification of paralogs within species

  • Genomic context examination:

    • Synteny analysis of regions surrounding aaeA

    • Identification of conserved operonic structures

    • Analysis of regulatory regions across species

    • Detection of mobile genetic elements

  • Selection analysis:

    • Calculation of dN/dS ratios across sequence alignments

    • Identification of positively selected residues

    • Analysis of conserved vs. variable regions

    • Correlation of sequence conservation with functional domains

  • Functional correlation:

    • Association of AaeA variants with ecological niches

    • Correlation with host ranges for pathogenic species

    • Association with metabolic capabilities

    • Relationship to antimicrobial resistance profiles

Research Questions Addressable Through Comparative Genomics:

  • Is AaeA primarily vertically inherited or subject to horizontal gene transfer?

  • Are there functional variants specialized for different ecological niches?

  • How do pathogenic E. coli strains differ from commensal strains in their AaeA sequences?

  • What selective pressures have shaped the evolution of this efflux system?

  • Are there correlations between AaeA sequence variations and bacterial lifestyle?

By combining these comparative genomic approaches with functional studies, researchers can gain a comprehensive understanding of how the AaeA efflux pump has evolved across bacterial species and adapted to different environmental challenges.

What are the most promising future research directions for understanding AaeA function and applying this knowledge in biotechnology and medicine?

The AaeA protein represents a specialized component of bacterial transport systems with significant potential for future research and applications. Several promising directions emerge from current knowledge:

Fundamental Research Opportunities:

  • Structural biology: Determining the high-resolution structure of AaeA alone and in complex with AaeB would provide critical insights into function

  • Physiological role: Further investigation of the "metabolic relief valve" hypothesis through metabolomics and in vivo studies

  • Regulatory networks: Mapping the complete regulatory network controlling aaeA expression under various conditions

  • Evolution and adaptation: Comparative analysis across diverse bacteria to understand evolutionary pressures

  • Host-pathogen interactions: Examining the role of AaeA in bacterial survival during infection

Biotechnological Applications:

  • Metabolic engineering: Utilizing AaeA to enhance production of aromatic compounds by reducing toxicity

  • Biosensor development: Creating biosensors for aromatic carboxylic acids based on the AaeR-AaeA regulatory system

  • Protein engineering: Developing AaeA variants with modified substrate specificity for specialized applications

  • Bioremediation: Engineering bacteria with enhanced capacity to process aromatic pollutants

  • Synthetic biology: Incorporating AaeA into designed cellular circuits for controlled response to specific compounds

Medical Relevance:

  • Antimicrobial development: Targeting AaeA or its regulation to potentiate existing antibiotics

  • Pathogenesis understanding: Clarifying the role of AaeA in bacterial survival during infection

  • Diagnostic applications: Using AaeA-based systems for detection of specific bacterial species

  • Microbiome modulation: Understanding how AaeA affects bacterial community dynamics

  • Drug delivery: Potential utilization of modified transport systems for targeted compound delivery

Methodological Advances Needed:

  • Development of high-throughput assays for AaeA function

  • Improved systems for membrane protein expression and characterization

  • Advanced imaging techniques to visualize AaeA localization and dynamics

  • In vivo reporters to monitor AaeA activity in complex environments

  • Computational models to predict substrate interactions and transport kinetics

The specialized nature of the AaeAB system, with its narrow substrate specificity for aromatic carboxylic acids , suggests it has evolved for specific physiological functions rather than general detoxification. This specialization makes it particularly valuable for applications requiring precise control of aromatic compound transport across membranes.

What key questions remain unanswered about AaeA structure, function, and regulation that would benefit from interdisciplinary research approaches?

Despite significant advances in understanding the AaeA protein, numerous critical questions remain that would benefit from interdisciplinary research approaches:

Structural Questions:

  • What is the high-resolution structure of AaeA, and how does it interact with AaeB?

  • Which domains are responsible for substrate recognition versus protein-protein interactions?

  • How does AaeA connect the inner membrane transporter to outer membrane components?

  • What conformational changes occur during the transport cycle?

  • How do specific amino acid residues contribute to substrate specificity?

Functional Questions:

  • What is the precise mechanism of aromatic carboxylic acid transport?

  • Does AaeA play roles beyond efflux, such as in cellular signaling?

  • How does AaeA contribute to bacterial survival under different stress conditions?

  • What is the full range of natural substrates for the AaeAB system?

  • How does AaeA function differ in various bacterial species and ecological niches?

Regulatory Questions:

  • What are the complete signaling pathways controlling aaeA expression?

  • How does metabolic status influence AaeA regulation?

  • What role does AaeX play in the function or regulation of the system?

  • Are there post-translational modifications affecting AaeA function?

  • How is AaeA expression coordinated with other cellular processes?

Interdisciplinary Approaches Required:

Question TypeDisciplines NeededMethodological Approaches
StructuralStructural biology, biophysics, computational biologyCryo-EM, X-ray crystallography, molecular dynamics, hydrogen-deuterium exchange MS
FunctionalBiochemistry, molecular biology, systems biologyTransport assays, metabolomics, genetic screens, live-cell imaging
RegulatoryGenetics, systems biology, computational biologyChIP-seq, RNA-seq, network modeling, proteomics
EvolutionaryBioinformatics, evolutionary biology, ecologyComparative genomics, population genetics, ecological sampling
TranslationalBioengineering, synthetic biology, pharmacologyDirected evolution, drug screening, animal models

Integrative Research Strategies:

  • Multi-omics approaches:

    • Combining transcriptomics, proteomics, and metabolomics to understand AaeA in cellular context

    • Integrating structural data with functional assays

    • Correlating genomic variations with functional differences

  • Computational-experimental feedback loops:

    • Using structural predictions to guide mutagenesis

    • Developing models of transport based on experimental data

    • Predicting regulatory networks for experimental validation

  • Cross-species comparative studies:

    • Examining AaeA function across diverse bacteria

    • Correlating sequence variations with functional differences

    • Understanding adaptation to different ecological niches

  • Technological development:

    • Creating improved assays for membrane protein function

    • Developing biosensors for real-time monitoring

    • Establishing high-throughput screening systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.