Recombinant Escherichia coli O9:H4 Phosphoglycerol transferase I (mdoB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdoB; opgB; EcHS_A4591; Phosphoglycerol transferase I; Phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-763
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
mdoB
Target Protein Sequence
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV LYTLTNSLTGAGVSKYILPGIGIVLGLTAVFGALGWILRRRRHHPHHFGYSLLALLLALG SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSKTIPDPKLNLVYIYGESLERTYFDNE AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS FSAVSCSQENIAAFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKTTWQGKTAFKD TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
Uniprot No.

Target Background

Function
This protein catalyzes the transfer of a phosphoglycerol residue from phosphatidylglycerol to the membrane-bound nascent glucan backbones.
Database Links
Protein Families
OpgB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the enzymatic function of Phosphoglycerol transferase I (mdoB) in E. coli?

Phosphoglycerol transferase I, encoded by the mdoB gene, catalyzes the in vitro transfer of phosphoglycerol residues from phosphatidylglycerol to membrane-derived oligosaccharides (MDO) or to model substrates such as arbutin (p-hydroxyphenyl-β-D-glucoside). The products of this reaction are phosphoglycerol diester derivatives of the acceptor molecules and sn-1,2-diglyceride . This enzyme is localized in the inner, cytoplasmic membrane of E. coli and plays a crucial role in the glycerophosphorylation of MDOs in vivo . Experimental evidence has confirmed this function, as mdoB mutants produce MDOs completely devoid of phosphoglycerol residues while maintaining normal levels of phosphoglycerol transferase II activity .

What is the structure and size of the full-length mdoB protein?

The full-length mdoB protein consists of 763 amino acids as demonstrated in recombinant expression systems . The protein sequence includes multiple transmembrane domains consistent with its localization in the bacterial inner membrane. When expressed recombinantly, the protein is often fused to a His-tag to facilitate purification and experimental manipulation . The complete amino acid sequence reveals a complex membrane protein structure (available in the search results) that includes hydrophobic regions necessary for membrane integration and functional domains required for catalytic activity .

How is mdoB genetically positioned in the E. coli genome?

Genetic mapping experiments using P1 transduction have established that the mdoB gene is closely linked to serB and less closely linked to thr in the E. coli genome. Three-factor crosses have determined the gene order to be mdoB-serB-thr in the clockwise direction . This genetic positioning is important for understanding the evolutionary context of the gene and for designing genetic manipulation experiments. The proximity to these genetic markers also provides useful reference points for genetic engineering and mutant construction .

What are the optimal conditions for assaying phosphoglycerol transferase I activity in vitro?

The standard assay for phosphoglycerol transferase I activity involves measuring the transfer of phosphoglycerol residues from phosphatidylglycerol to arbutin or other model substrates. For reliable results, researchers should use membrane preparations from E. coli cells in a buffer containing Tris/PBS at pH 8.0 . The reaction mixture typically contains phosphatidylglycerol as the donor and arbutin as the acceptor. Activity is commonly measured in nmol/h per mg of protein, with wild-type strains showing approximately 6.0 nmol/h per mg of protein under standard conditions .

When working with recombinant His-tagged protein, the purified enzyme should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C is recommended to maintain enzyme activity . Repeated freeze-thaw cycles should be avoided to prevent loss of enzymatic function .

How can researchers apply Design of Experiments (DoE) to optimize mdoB expression and activity studies?

Design of Experiments (DoE) offers a powerful approach for optimizing complex biological systems such as recombinant protein expression. For mdoB research, DoE can be applied to systematically investigate factors affecting protein expression, purification, and enzymatic activity while minimizing the number of experiments required .

Key factors to consider in a DoE approach for mdoB studies include:

  • Expression parameters: temperature, IPTG concentration, induction time

  • Buffer composition: pH, salt concentration, detergent type/concentration

  • Assay conditions: substrate concentration, reaction time, temperature

An example factorial design for optimizing mdoB expression might look like this:

FactorLow LevelHigh Level
Temperature25°C37°C
IPTG Concentration0.1 mM1.0 mM
Induction Time4 hours16 hours
Media CompositionLB2YT

DoE allows researchers to identify not only the main effects of each factor but also interaction effects between factors, which is particularly valuable for complex biological systems . Statistical analysis of the results can then identify optimal conditions for maximizing protein yield and activity.

How do phosphoglycerol transferase I and II functionally interact in the bacterial membrane biology?

Phosphoglycerol transferase I (mdoB) and phosphoglycerol transferase II represent a fascinating case of complementary enzyme systems in bacterial membrane biology. While both enzymes deal with phosphoglycerol moieties, they have distinct functions and cellular localizations. Phosphoglycerol transferase I is an inner membrane enzyme that catalyzes the primary transfer of phosphoglycerol residues from phosphatidylglycerol to MDO . In contrast, phosphoglycerol transferase II is a soluble, periplasmic enzyme that does not utilize phosphatidylglycerol as a donor but catalyzes the interchange of phosphoglycerol residues among soluble MDO species .

Research has confirmed that mdoB mutations completely eliminate phosphoglycerol transferase I activity while leaving phosphoglycerol transferase II activity intact (0.31 U/mg of protein per h in wild-type strain AB1133 and 0.33 U/mg of protein per h in mdoB mutant strain PT227) . This functional separation suggests a two-step process in MDO modification: phosphoglycerol transferase I performs the initial transfer from the membrane phospholipid to MDO, while phosphoglycerol transferase II may subsequently redistribute these residues among different MDO molecules in the periplasm to achieve optimal distribution .

What are the methodological approaches for characterizing mdoB mutants?

Characterization of mdoB mutants requires a multi-faceted approach combining genetic, biochemical, and analytical techniques. Based on published research, the following methodological framework is recommended:

How can researchers distinguish between different strains of recombinant E. coli expressing phosphoglycerol transferase I?

Distinguishing between different strains of recombinant E. coli expressing phosphoglycerol transferase I requires a combination of genetic, biochemical, and functional analyses:

  • Serotyping: Different E. coli strains (e.g., O6:K15:H31 vs. O9:H4) can be distinguished based on their O antigen, K antigen, and H antigen profiles using specific antibodies or PCR-based methods targeting strain-specific genetic markers .

  • Protein sequence analysis: Recombinant proteins can be analyzed by mass spectrometry to identify strain-specific sequence variations. Even though the core function of phosphoglycerol transferase I is conserved, amino acid differences may exist between strains .

  • Enzymatic activity profiles: Detailed kinetic analysis of the enzyme from different strains may reveal subtle differences in substrate specificity, reaction rates, or optimal conditions. This can be performed using standardized assays with various model substrates .

  • Tag detection: Recombinant versions of the protein often contain fusion tags (such as His-tags) that can be detected via Western blotting or other immunological methods. The position and type of tag may differ between constructs from different laboratories .

What are common issues in recombinant expression of mdoB and how can they be addressed?

Recombinant expression of membrane proteins like mdoB presents several challenges. Here are common issues and their solutions:

  • Low expression levels:

    • Problem: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize expression conditions using DoE approaches . Consider using specialized E. coli strains designed for membrane protein expression (C41, C43). Lower induction temperatures (16-25°C) and extended expression times often improve yield .

  • Protein aggregation/inclusion body formation:

    • Problem: Overexpressed mdoB may form insoluble aggregates.

    • Solution: Express at lower temperatures with reduced inducer concentrations. Addition of compatible solutes (glycine betaine, proline) or mild detergents to the growth medium can help maintain solubility .

  • Protein inactivation during purification:

    • Problem: Loss of activity during purification steps.

    • Solution: Maintain appropriate detergent concentrations throughout purification. Include glycerol (5-50%) in storage buffers and avoid repeated freeze-thaw cycles . Consider purifying in the presence of phospholipids to stabilize the protein.

  • Difficulty in assessing purity and quantity:

    • Problem: Membrane proteins can be difficult to visualize on standard SDS-PAGE.

    • Solution: Use specialized membrane protein stains or Western blotting with tag-specific antibodies. For quantification, BCA assays are often more reliable than Bradford assays for membrane proteins .

How can researchers troubleshoot contradictory results in mdoB functional studies?

When researchers encounter contradictory results in mdoB functional studies, systematic troubleshooting approaches are essential:

  • Strain variation assessment: Confirm the exact strain and sequence of your mdoB construct. Even minor variations in protein sequence can affect function. Perform complementation tests with known wild-type mdoB to verify phenotypes .

  • Enzyme activity validation: Use multiple assay methods to confirm enzyme activity. For phosphoglycerol transferase I, both the arbutin-based assay and MDO modification assays should yield consistent results . If discrepancies exist, examine assay conditions carefully, particularly detergent concentrations which can affect membrane protein activity.

  • Substrate quality control: The quality of phosphatidylglycerol and other substrates is critical. Perform lipid analysis to confirm substrate composition and purity. Oxidized lipids can significantly alter enzyme kinetics.

  • Experimental design analysis: Apply DoE principles to systematically assess factors that might explain contradictory results . This approach can identify interaction effects between variables that might not be apparent in traditional one-factor-at-a-time experiments.

  • Data normalization and analysis: Ensure appropriate statistical methods are applied to experimental data. For complex datasets, consider multivariate analysis approaches to identify patterns that might explain apparent contradictions .

What are the emerging research questions regarding phosphoglycerol transferase I?

Based on current literature, several promising research directions emerge for phosphoglycerol transferase I:

  • Structural biology: Despite functional characterization, detailed structural information about phosphoglycerol transferase I remains limited. Cryo-EM or X-ray crystallography studies could provide insights into the catalytic mechanism and substrate binding sites.

  • Systems biology integration: Understanding how mdoB activity integrates with broader cellular processes, including envelope stress responses and adaptation to environmental changes, remains an important research area.

  • Comparative genomics: Analyzing phosphoglycerol transferase I variants across different bacterial species could reveal evolutionary patterns and functional adaptations. This may also identify conserved domains crucial for enzymatic activity.

  • Biotechnological applications: The ability of phosphoglycerol transferase I to modify glycosides suggests potential applications in glycoengineering and biosynthesis of novel compounds.

  • Antimicrobial development: Given its role in membrane biology, mdoB might represent a target for developing novel antimicrobials. Understanding its structure and function could inform drug design strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.