Recombinant Escherichia coli O9:H4 Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; EcHS_A0743; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
kdpC
Target Protein Sequence
MSGLRPALSTFIFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNFT GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASTSVPVEL VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE LNLALDKLDE
Uniprot No.

Target Background

Function
The recombinant *Escherichia coli* O9:H4 Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. This system catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by forming a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is E. coli O9:H4 and how does it relate to other E. coli serotypes?

E. coli O9:H4 belongs to the O9 serogroup, which shares antigenic similarities with the O104 serogroup. Serological testing has revealed a significant cross-reaction between E. coli O9 and O104 antisera, indicating shared antigenic epitopes between these serogroups . When working with these strains, researchers should be aware that absorption tests may be necessary to confirm serotype specificity.

The O9 serogroup strains, like many other E. coli serotypes, can harbor various diarrheagenic E. coli (DEC) genes in different combinations. Based on phylogenetic analysis, E. coli O9 strains typically belong to commensal phylogenetic groups A and B1, though they can acquire virulence factors through horizontal gene transfer . This genetic flexibility makes these strains particularly important for studying bacterial evolution and pathogenicity mechanisms.

What is the biological function of kdpC in E. coli and why is it significant for research?

The kdpC gene encodes the Potassium-transporting ATPase C chain, a critical component of the high-affinity Kdp-ATPase complex in E. coli. This complex consists of four subunits (KdpA, KdpB, KdpC, and KdpF) and functions as an emergency K+ uptake system activated under conditions of potassium limitation or osmotic stress.

Within this complex, KdpC serves as a stabilizing subunit that connects the catalytic KdpB subunit with the K+-transporting KdpA subunit. The Kdp system plays essential roles in:

  • Maintaining intracellular potassium homeostasis

  • Regulating cell turgor pressure

  • Supporting pH regulation

  • Ensuring optimal enzyme activity

The kdpC gene is part of the kdpFABC operon, which is regulated by the KdpDE two-component system that responds to environmental K+ concentrations. This system represents an excellent model for studying bacterial osmoregulation, membrane protein complexes, and prokaryotic signal transduction.

How are E. coli O9 strains typically classified phylogenetically?

E. coli O9 strains, similar to O104 strains, are predominantly classified within the commensal phylogenetic groups A and B1 based on PCR detection of specific marker genes (arpA, chuA, yjaA, and TspE4.C2) . This phylogenetic classification provides important context for understanding the evolutionary relationships between different E. coli strains.

Research has shown that these phylogenetic groups can contain strains with various combinations of virulence genes. In the case of E. coli O9 strains, they can harbor genes associated with multiple pathotypes, including:

  • Enteropathogenic E. coli (EPEC)

  • Enteroaggregative E. coli (EAEC)

  • Shiga toxin-producing E. coli (STEC)

This genetic diversity within phylogenetic groups highlights the dynamic genome of E. coli and the potential for horizontal gene transfer to contribute to pathogenicity. When working with E. coli O9:H4 for recombinant protein expression, researchers should consider characterizing their specific strain to understand its genetic background and potential virulence factors.

What experimental approaches are recommended for studying recombinant kdpC expression in E. coli O9:H4?

For optimal expression of recombinant kdpC in E. coli O9:H4, researchers should implement a comprehensive strategy that addresses the challenges of membrane protein expression:

  • Vector Selection and Design:

    • Consider positive selection vectors like pGRASS that allow visual identification of successful transformants through antisense reporter systems

    • Incorporate inducible promoters (T7 or araBAD) for precise expression control

    • Include affinity tags strategically positioned to minimize functional interference

    • Optimize the ribosome binding site sequence for efficient translation

  • Membrane Protein Expression Optimization:

    • Employ lower induction temperatures (16-25°C) to facilitate proper membrane insertion

    • Test specialized E. coli strains engineered for membrane protein expression

    • Consider co-expression with chaperones to improve folding efficiency

    • Evaluate different growth media formulations to support membrane protein synthesis

  • Expression Monitoring and Validation:

    • Implement Western blotting with tag-specific antibodies

    • Develop activity assays specific to kdpC functionality

    • Use fluorescence microscopy to confirm proper membrane localization

    • Apply protease accessibility assays to verify correct topology

  • Purification Strategy Development:

    • Screen multiple detergents for optimal solubilization

    • Implement a multi-step purification scheme including affinity chromatography followed by size exclusion

    • Consider reconstitution into nanodiscs or liposomes for functional studies

    • Validate purified protein through biophysical characterization techniques

These strategies should be systematically optimized for the specific characteristics of E. coli O9:H4 to ensure reproducible results.

How do the genetic characteristics of E. coli O9:H4 influence recombinant protein expression?

The genetic background of E. coli O9:H4 can significantly impact recombinant protein expression through multiple mechanisms:

Genetic FactorImpact on ExpressionOptimization Strategy
Phylogenetic group (typically A or B1) Affects cellular physiology and stress responsesSelect expression conditions tailored to strain characteristics
Presence of virulence genes May alter metabolism and energy allocationConsider removing non-essential virulence factors
Strain-specific proteasesCan degrade recombinant proteinsUse protease-deficient derivatives or protease inhibitors
Codon usage biasAffects translation efficiencyOptimize codons for E. coli O9:H4 usage patterns
Cell envelope characteristicsInfluences membrane protein integrationModify membrane composition through supplementation

Research has shown that E. coli O9 strains can contain various virulence genes in different combinations, which may affect cellular processes relevant to recombinant protein expression . Additionally, these strains typically belong to commensal phylogenetic groups with distinct regulatory networks that can interact with expression systems.

To optimize expression, researchers should consider:

  • Comparative expression testing in multiple strain backgrounds

  • Genomic characterization of the specific O9:H4 strain being used

  • Tailoring expression conditions to match strain-specific characteristics

  • Genetic modification to remove interfering elements

What challenges might researchers face when working with potentially pathogenic E. coli strains for recombinant protein studies?

When working with E. coli O9:H4 strains that may contain virulence genes, researchers must address several important challenges:

  • Biosafety Considerations:

    • Implement appropriate containment facilities (typically BSL-2)

    • Develop and follow strict laboratory safety protocols

    • Establish proper decontamination and waste disposal procedures

    • Conduct comprehensive risk assessments for all experimental procedures

Studies have shown that E. coli O9 strains, like O104 strains, can contain various diarrheagenic E. coli (DEC) genes, including those associated with STEC, EAEC, and EPEC pathotypes . The presence of these genes necessitates careful handling.

  • Technical Challenges:

    • Account for potential interference of virulence factors with expression systems

    • Address altered growth characteristics that may affect standard protocols

    • Monitor for potential toxicity to the host cell from the expression system

    • Develop specialized purification protocols that maintain containment

  • Regulatory Compliance:

    • Obtain necessary permits and approvals before beginning work

    • Maintain compliance with institutional biosafety committee requirements

    • Keep detailed documentation of all procedures and safety measures

    • Address any transport and shipping restrictions for potentially pathogenic strains

Researchers should consider using attenuated laboratory strains when possible, or implementing genetic modifications to remove virulence factors while maintaining the necessary characteristics for protein expression.

How can researchers optimize expression systems for membrane proteins like kdpC in E. coli?

Optimizing expression systems for membrane proteins like kdpC requires addressing several key challenges unique to membrane protein biology:

  • Expression Vector Design Elements:

    • Implement low-copy number vectors to prevent overwhelming membrane insertion machinery

    • Utilize tightly controlled inducible promoters to minimize toxic effects

    • Include fusion partners that aid in proper folding and membrane targeting

    • Consider positive selection vectors like pGRASS that facilitate the identification of successful clones

  • Host Strain Selection Criteria:

    • Evaluate strains with mutations in specific proteases (e.g., BL21(DE3))

    • Test strains overexpressing rare tRNAs for codon optimization

    • Consider C41(DE3) and C43(DE3) strains specifically developed for membrane protein expression

    • Assess strains with altered membrane compositions that may facilitate insertion

  • Growth and Induction Condition Optimization:

    • Implement lower temperatures (16-25°C) during the induction phase

    • Test reduced inducer concentrations to slow expression rate

    • Supplement media with specific lipids or precursors to support membrane biogenesis

    • Add chemical chaperones or osmolytes to improve folding efficiency

  • Co-expression Strategies:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Consider co-expression with components of membrane protein insertion machinery

    • For kdpC specifically, evaluate co-expression with other Kdp subunits for proper complex formation

These optimization strategies should be systematically tested to determine the optimal conditions for kdpC expression in the specific context of E. coli O9:H4.

What selection markers and expression vectors are suitable for recombinant kdpC studies?

Selecting appropriate vectors and markers is critical for successful kdpC expression:

  • Recommended Selection Markers:

    • Antibiotic resistance genes (ampicillin, kanamycin, chloramphenicol)

    • Visual selection systems using GFP or similar reporters as implemented in pGRASS

    • Complementation markers for auxotrophic selection when antibiotic use is undesirable

  • Vector Features for Membrane Protein Expression:

  • Critical Vector Elements for kdpC Expression:

    • Optimized signal sequences for proper membrane targeting

    • Strategically positioned affinity tags (N-terminal vs. C-terminal)

    • Cleavable linkers between tags and target protein

    • Ribosome binding site variants to control translation efficiency

  • Specialized Elements for Membrane Proteins:

    • Cold-inducible promoters for slower, more controlled expression

    • Dual tag systems for improved purification options

    • Fluorescent fusion partners for localization studies

    • Tetracycline-responsive elements for fine expression control

The optimal vector system should be determined through comparative testing with your specific kdpC construct and E. coli O9:H4 strain.

How can researchers verify the structural integrity and functionality of recombinant kdpC?

Verifying both structural integrity and functionality of recombinant kdpC requires a multi-faceted approach:

A systematic workflow combining multiple complementary techniques will provide comprehensive validation of recombinant kdpC quality and functionality.

What protocols exist for isolating and purifying membrane proteins like kdpC from E. coli?

Isolating and purifying membrane proteins like kdpC requires specialized protocols designed to maintain structural integrity and functionality:

  • Membrane Preparation Protocol:
    a. Cell disruption methods:

    • French press (20,000 psi, 2-3 passes)

    • Sonication (10 cycles of 30s on/30s off at 40% amplitude)

    • Enzymatic lysis (lysozyme treatment followed by osmotic shock)

    b. Differential centrifugation procedure:

    • Low-speed centrifugation (10,000×g, 20 min) to remove cell debris

    • Ultracentrifugation (150,000×g, 1 hour) to isolate membrane fraction

    • Multiple membrane washing steps to remove peripheral proteins

  • Membrane Protein Solubilization Options:

DetergentCMC (mM)Micelle Size (kDa)Best ApplicationsLimitations
DDM0.1770General membrane protein extractionLarge micelles
LMNG0.0135Enhanced stability during purificationHigher cost
Digitonin~0.570-100Native-like environment preservationBatch variability
CHAPSO8.011Maintaining protein-protein interactionsLess efficient solubilization
Triton X-1000.2-0.980Economical optionUV absorbance interference
  • Purification Strategy Development:
    a. Affinity chromatography options:

    • IMAC (Ni-NTA) for His-tagged constructs

    • Anti-FLAG for FLAG-tagged proteins

    • Strep-Tactin for Strep-tagged proteins

    b. Secondary purification steps:

    • Ion exchange chromatography based on theoretical pI

    • Size exclusion chromatography for final polishing

    • Hydroxyapatite chromatography for difficult separations

    c. Advanced techniques:

    • Lipid cubic phase methods for highly hydrophobic proteins

    • Nanodisc or SMALP formation for detergent-free purification

    • On-column detergent exchange procedures

  • Quality Control Testing:

    • SDS-PAGE and western blotting with specific antibodies

    • Mass spectrometry for purity and integrity verification

    • Dynamic light scattering for homogeneity assessment

    • Thermal stability analysis to evaluate proper folding

These protocols should be optimized for the specific characteristics of kdpC and the E. coli O9:H4 expression system being used.

How should researchers interpret contradictory results in kdpC functional studies?

When faced with contradictory results in kdpC functional studies, researchers should implement a systematic approach to interpretation:

  • Methodological Analysis Strategy:

    • Compare experimental conditions across studies (temperature, pH, ionic strength, buffer components)

    • Evaluate differences in protein preparation (tags, purification methods, detergents used)

    • Assess expression systems employed (vector design, host strain characteristics, induction parameters)

    • Consider the impact of using E. coli O9:H4 versus standard laboratory strains

Research has shown that E. coli O9 strains display significant genetic diversity with multiple serotypes and variable gene content . These strain-specific differences could explain apparently contradictory functional results.

  • Structural and Conformational Considerations:

    • Examine if contradictory results might reflect different conformational states of kdpC

    • Consider the impact of the membrane environment (native membrane vs. detergent micelles)

    • Evaluate the influence of interactions with other Kdp complex components

    • Assess post-translational modifications or processing differences

  • Statistical Analysis Framework:

    • Perform meta-analysis when multiple datasets are available

    • Implement multivariate analysis to identify factors contributing to differences

    • Apply Bayesian approaches to weight evidence from different sources

    • Develop statistical models that account for experimental variability

  • Experimental Resolution Approaches:

    • Design specific experiments to directly address contradictions

    • Use orthogonal techniques to validate findings

    • Establish collaborations with groups reporting contradictory results

    • Consider blind replication studies to eliminate unconscious bias

  • Interpretation Framework Development:

    • Create a conceptual model that accommodates seemingly contradictory results

    • Consider that contradictions may reflect real biological complexity or strain differences

    • Evaluate if differences are quantitative (magnitude) or qualitative (mechanism)

    • Integrate findings into the broader context of potassium transport systems

What statistical approaches are appropriate for analyzing kdpC expression levels across different conditions?

Analyzing kdpC expression across diverse experimental conditions requires robust statistical methods:

  • Experimental Design Considerations:

    • Include sufficient biological replicates (minimum n=3, preferably n≥5)

    • Incorporate technical replicates to assess measurement variability

    • Design factorial experiments to evaluate interaction effects

    • Include appropriate reference standards for normalization

  • Data Normalization Methods:

    • Reference gene normalization for transcriptional studies

    • Total protein normalization for Western blot analysis

    • Internal standard normalization for mass spectrometry

    • Housekeeping protein normalization for expression studies

  • Statistical Tests for Hypothesis Testing:

Statistical TestApplication ScenarioStrengthsLimitationsImplementation
Student's t-testComparing two conditionsStraightforward, widely acceptedLimited to two groupsR: t.test(), GraphPad Prism
ANOVA with post-hoc testsMultiple condition comparisonExamines multiple factorsRequires post-hoc testingR: aov(), followed by TukeyHSD()
Non-parametric testsNon-normally distributed dataNo normality assumptionLower statistical powerR: wilcox.test(), kruskal.test()
Mixed-effects modelsNested or hierarchical designsAccounts for random effectsComplex interpretationR: lme4 package
  • Advanced Statistical Methods:

    • Principal Component Analysis (PCA) for multivariate data reduction

    • Hierarchical clustering to identify expression patterns

    • Regression models to identify predictive factors

    • Time series analysis for temporal expression data

  • Visualization Approaches:

    • Box plots showing distribution characteristics

    • Heatmaps for comparing multiple conditions simultaneously

    • Volcano plots for highlighting significant changes

    • Interaction plots for understanding factor relationships

  • Reporting Standards:

    • Include effect sizes alongside p-values

    • Report confidence intervals for all measurements

    • Clearly state multiple testing correction methods

    • Make raw data available for independent reanalysis

The selection of appropriate statistical methods should be guided by the specific experimental design, sample size, and data characteristics of your kdpC expression study.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.