Recombinant Escherichia coli O9:H4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant ArnE

Recombinant Escherichia coli O9:H4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE) is a bioengineered protein derived from the arnE gene in E. coli O9:H4 serotype. This protein is critical for lipid A modification in lipopolysaccharide (LPS) biosynthesis, a process linked to bacterial antibiotic resistance and immune evasion .

Research Findings and Biological Relevance

4.1. Mechanistic Insights

  • Substrate specificity: Requires Z-configured double bonds in lipid precursors for efficient transfer by ArnT .

  • Genetic context: Part of the pmrHFIJKLM operon, regulated by PmrA under low-Mg²⁺ conditions .

4.2. Antibiotic Resistance Implications

MechanismImpact
L-Ara4N additionReduces cationic antibiotic binding to lipid A .
Flippase activityEnables periplasmic transfer of modified lipid precursors .

4.3. Biochemical Applications

  • ELISA assays: Used to study ArnE-specific antibodies or protein interactions .

  • Enzymatic studies: Serves as a substrate for ArnT transferase activity in vitro .

Comparative Analysis with Homologs

SpeciesUniProt IDKey Differences
Klebsiella pneumoniaeB5XTL2 112 aa; distinct phospholipid-binding motifs
Yersinia pseudotuberculosisQ66A07 114 aa; altered transmembrane regions
E. coli O9:H4A8A2C5 Optimized for ELISA applications

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnE; EcHS_A2403; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
arnE
Target Protein Sequence
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV
Uniprot No.

Target Background

Function
ArnE, the probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit, facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane in Escherichia coli O9:H4.
Database Links
Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is arnE and what is its function in bacterial systems?

ArnE (formerly known as PmrL) functions as a subunit of a flippase system that translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane in bacteria . This transport mechanism is crucial for the modification of lipid A with the L-Ara4N moiety, which is required for resistance to polymyxin and cationic antimicrobial peptides. The protein belongs to the ArnE family and has been characterized in various bacterial species including Yersinia pseudotuberculosis serotype O:3, with a molecular weight of approximately 12.9 kDa (114 amino acids) .

How does the arnE protein interact with other components in the Arn pathway?

ArnE forms a functional heterodimeric complex with ArnF (formerly PmrM) to facilitate the translocation of undecaprenyl phosphate-α-L-Ara4N across the inner membrane . This transport system fits into a larger biosynthetic pathway that includes:

  • Conversion of UDP-glucose to UDP-glucuronic acid

  • Oxidative decarboxylation by ArnA to generate UDP-4-ketopentose

  • Transamination by ArnB to form UDP-β-L-Ara4N

  • N-formylation by ArnA's N-terminal domain

  • Transfer of L-Ara4N to undecaprenyl phosphate by ArnC

  • Deformylation by ArnD

  • Translocation across the inner membrane by ArnE/ArnF

  • Transfer of L-Ara4N to lipid A by ArnT on the periplasmic side

Disruption of either ArnE or ArnF results in polymyxin sensitivity despite normal levels of undecaprenyl phosphate-α-L-Ara4N in the membrane, indicating their essential role in the spatial positioning of this precursor molecule .

What approaches should be used to select appropriate E. coli strains for recombinant arnE studies?

When selecting E. coli strains for arnE studies, researchers should consider several factors based on the specific experimental goals:

Experimental PurposeRecommended Strain TypesRationale
Gene cloningRecA- strains (e.g., DH5α, TOP10)Reduced recombination prevents plasmid instability
Protein expressionBL21(DE3) derivativesOptimized for high-level protein production with reduced proteolysis
Membrane protein studiesC41(DE3), C43(DE3)Specifically engineered to handle potentially toxic membrane proteins
Functional studiesK-12 derived strainsWell-characterized genetic background for functional assessment

The selection process should include evaluation of:

  • Genetic background (mutations affecting relevant pathways)

  • Compatibility with expression vectors (T7, araBAD, tac promoters)

  • Growth characteristics and media requirements

  • Codon optimization considerations

  • Potential toxicity of overexpressed membrane proteins

How should experimental controls be designed for arnE functional studies?

  • Positive controls: Wild-type strain with functional arnE expression

  • Negative controls:

    • arnE knockout strain

    • Vector-only transformants

    • Inactive point mutant of arnE

  • Complementation controls: arnE knockout complemented with functional gene copy

  • Specificity controls: Related proteins from the same family or pathway

Additionally, researchers should implement:

  • Randomization procedures to minimize selection bias

  • Blinding during phenotypic assessments

  • Appropriate statistical power analysis to determine sample sizes

  • Technical and biological replicates

  • Controls for plasmid copy number effects when using recombinant systems

What methods can be used to assess undecaprenyl phosphate-α-L-Ara4N flipping activity?

Based on published methodologies, researchers can employ several approaches to assess flippase activity:

  • Membrane-impermeable labeling: Use of N-hydroxysulfosuccinimidobiotin to quantify accessible undecaprenyl phosphate-α-L-Ara4N on the periplasmic surface of the inner membrane. Studies have shown 4-5 fold reduced labeling in arnE mutants compared to wild-type strains, indicating decreased translocation of the substrate .

  • Antimicrobial susceptibility testing: Polymyxin minimum inhibitory concentration (MIC) determination as a functional readout of L-Ara4N modification of lipid A, which depends on proper flippase activity.

  • Mass spectrometry analysis: Direct quantification of lipid A modifications to determine the efficiency of L-Ara4N transfer, which is dependent on proper substrate flipping.

  • Reconstitution assays: In vitro reconstitution of the flippase complex in liposomes with fluorescently labeled substrates to directly measure transport activity.

How can researchers design experiments to differentiate between arnE mutations affecting protein expression versus functional defects?

Distinguishing between expression and functional defects requires a multi-faceted experimental approach:

  • Protein quantification:

    • Western blotting with specific antibodies

    • Epitope tagging (His, FLAG) for detection if antibodies aren't available

    • qRT-PCR to assess transcript levels

  • Subcellular localization:

    • Membrane fractionation to confirm proper targeting

    • Fluorescent protein fusions to visualize localization

    • Protease accessibility assays to determine orientation

  • Functional assessment:

    • In vivo complementation of arnE mutants

    • Polymyxin resistance assays

    • Direct measurement of undecaprenyl phosphate-α-L-Ara4N flipping

  • Structure-function analysis:

    • Site-directed mutagenesis of conserved residues

    • Chimeric proteins with related flippases

    • Co-immunoprecipitation to assess interaction with ArnF

This layered approach allows researchers to differentiate between mutations that affect protein stability, membrane integration, or specific functional domains .

What strategies should be employed to minimize bias in arnE research studies?

To minimize bias and enhance reproducibility in arnE research, investigators should:

  • Preregister studies: Document hypotheses, methods, and analysis plans before conducting experiments .

  • Implement blinding strategies:

    • Use coded samples for phenotypic assessment

    • Have different researchers perform experiments and data analysis

    • Automated measurement systems when possible

  • Randomization procedures:

    • Random assignment of bacterial cultures to treatment groups

    • Random processing order of samples

    • Randomized plate position for growth assays

  • Control for batch effects:

    • Include internal controls in each experimental batch

    • Use mixed-effects statistical models to account for batch variation

    • Process critical comparisons within the same batch

  • Transparent reporting:

    • Follow ARRIVE guidelines for in vivo experiments

    • Report all experimental conditions in detail

    • Disclose any deviations from preregistered protocols

    • Make raw data and analysis code available

What strategies can be employed to investigate the structural basis of arnE function?

Understanding the structural basis of arnE function requires sophisticated approaches:

  • Structural determination:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for the ArnE/ArnF complex

    • NMR studies of purified protein in membrane mimetics

    • Computational modeling based on homologous proteins

  • Functional mapping:

    • Systematic alanine scanning mutagenesis of transmembrane domains

    • Cysteine accessibility methods to map substrate-binding pocket

    • Cross-linking studies to identify residues in close proximity to substrates

    • Charge reversal mutations to identify electrostatic interactions

  • Dynamics assessment:

    • Hydrogen-deuterium exchange mass spectrometry

    • Site-specific fluorescence labeling for conformational studies

    • Molecular dynamics simulations to predict substrate transport pathway

  • Interaction studies:

    • Co-purification of ArnE/ArnF complex

    • Cross-linking coupled with mass spectrometry

    • Fluorescence resonance energy transfer (FRET) to assess protein-protein interactions

How can researchers investigate the regulation of arnE expression under different environmental conditions?

To study arnE regulation under different environmental conditions:

  • Transcriptional regulation:

    • Reporter gene fusions (GFP, luciferase) to arnE promoter

    • Quantitative RT-PCR under various conditions

    • Chromatin immunoprecipitation to identify transcription factor binding

    • Promoter mapping through deletion analysis

  • Environmental triggers:

    • Systematic testing of pH, temperature, osmolarity, and nutrient conditions

    • Exposure to sublethal concentrations of antimicrobial peptides

    • Simulated host environment conditions (serum, tissue fluids)

    • Two-component system mutant screening

  • Post-transcriptional control:

    • mRNA stability assessments

    • Ribosome profiling to evaluate translation efficiency

    • Small RNA interaction studies

    • RNA structure mapping

  • Post-translational regulation:

    • Protein turnover rates under different conditions

    • Phosphoproteomic analysis to identify modifications

    • Protein-protein interaction network changes

What statistical approaches are most appropriate for analyzing experimental data related to arnE function?

For robust data analysis in arnE functional studies:

  • Power analysis:

    • Calculate required sample sizes based on expected effect sizes

    • Consider both biological and technical replication needs

    • Account for potential variability in bacterial systems

  • Appropriate statistical tests:

    • Parametric tests (t-test, ANOVA) when assumptions are met

    • Non-parametric alternatives when data doesn't follow normal distribution

    • Multiple comparison corrections (Bonferroni, Benjamini-Hochberg) for multiple hypotheses

    • Nested designs to account for technical replicates within biological replicates

  • Advanced modeling:

    • Mixed-effects models to account for random factors

    • Time-series analysis for growth or kill-curve data

    • Bayesian approaches to incorporate prior knowledge

    • Multivariate analysis for complex phenotypic data

  • Reporting standards:

    • Effect sizes with confidence intervals

    • Exact p-values rather than thresholds

    • Data visualization that represents variability

    • Transparent description of all data exclusions or transformations

How should researchers address contradictory findings in arnE research?

When facing contradictory findings in arnE research:

  • Systematic evaluation of differences:

    • Compare exact strain backgrounds and genetic constructs

    • Examine differences in growth conditions and media composition

    • Assess methodological variations in assay procedures

    • Consider differences in measurement techniques and instruments

  • Replication strategies:

    • Independent replication within the same laboratory

    • Collaboration with external laboratories for validation

    • Use of multiple complementary techniques to assess the same phenomenon

    • Systematic variation of key parameters to identify conditional effects

  • Literature synthesis:

    • Meta-analysis of published studies when sufficient data exists

    • Systematic review with quality assessment of methodologies

    • Identification of moderator variables that might explain discrepancies

    • Development of standardized protocols based on consensus methods

  • Response to contradictions:

    • Direct experimental testing of competing hypotheses

    • Development of more sensitive or specific assays

    • Consideration of context-dependent effects

    • Publication of negative results and methodological challenges

What emerging technologies could advance our understanding of arnE function?

Several cutting-edge technologies offer promising approaches for arnE research:

  • CRISPR-Cas9 applications:

    • Precise genome editing for clean mutations without polar effects

    • CRISPRi for tunable gene repression

    • Base editing for specific amino acid substitutions

    • Large-scale functional screening of arnE variants

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize membrane protein distribution

    • Single-molecule tracking to observe dynamics in living cells

    • Correlative light and electron microscopy for structural context

    • Label-free imaging methods to avoid fusion protein artifacts

  • High-throughput functional assays:

    • Microfluidic systems for rapid phenotypic assessment

    • Deep mutational scanning to comprehensively map functional residues

    • Synthetic genetic array analysis to identify genetic interactions

    • Automated growth and susceptibility testing platforms

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Network analysis of polymyxin resistance pathways

    • Mathematical modeling of lipid A modification dynamics

    • Machine learning to predict resistance phenotypes from genetic data

How can researchers effectively design experiments to investigate the potential of arnE as an antimicrobial target?

To investigate arnE as a potential antimicrobial target:

  • Target validation strategies:

    • Conditional depletion systems to confirm essentiality under relevant conditions

    • Animal infection models to assess impact on virulence

    • Comparison of targeting efficacy across different bacterial species

    • Assessment of resistance development frequency

  • Inhibitor discovery approaches:

    • Structure-based virtual screening if structural data is available

    • High-throughput biochemical assays for flippase activity

    • Whole-cell screening with polymyxin-sensitive reporter strains

    • Fragment-based drug discovery for membrane protein targets

  • Combination therapy assessment:

    • Checkerboard assays with existing antimicrobials

    • Time-kill studies to assess synergistic effects

    • Resistance development studies with combination treatments

    • Pharmacokinetic/pharmacodynamic modeling

  • Translational considerations:

    • Selectivity profiling against human membrane transporters

    • Cytotoxicity testing in mammalian cell lines

    • Formulation strategies for membrane-active compounds

    • Pharmacological property optimization for drug-like characteristics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.