Recombinant Escherichia coli O9:H4 Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
arnF; EcHS_A2404; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
arnF
Target Protein Sequence
MGLIWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPMTKQRY
Uniprot No.

Target Background

Function
This protein functions as a 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) flippase, translocating it across the inner membrane from the cytoplasmic to the periplasmic side in *Escherichia coli* O9:H4.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of arnF in Escherichia coli O9:H4?

ArnF functions as a flippase subunit that facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across the cytoplasmic membrane. It is part of the Arn pathway that modifies lipopolysaccharide (LPS) structure by adding aminoarabinose to lipid A, which can alter bacterial resistance to certain antimicrobial compounds . The protein contains transmembrane domains characteristic of flippases, with analysis showing a predominantly hydrophobic amino acid sequence consistent with membrane integration . Sequence analysis reveals that the 128-145 amino acid protein contains multiple transmembrane helices which facilitate its function in membrane transport processes .

What expression systems are most effective for producing recombinant arnF protein?

Successful expression strategies include:

Expression SystemAdvantagesChallengesRecommended Controls
E. coli BL21(DE3)High yield, simple induction with IPTGPotential inclusion body formationExpress non-toxic control protein in parallel
E. coli B strainsBetter metabolism for higher-quality proteinStrain-specific expression differencesCompare with K12 expression levels
E. coli with T7 RNA polymerase controlTunable expression levelsMay require optimization of inducer concentrationUse < 0.1 mM IPTG to reduce toxicity

When expressing membrane proteins like arnF, it's important to monitor both cell viability and protein folding, as improper folding can lead to a metabolic burden on the host cells .

What biosafety considerations apply when working with recombinant E. coli expressing arnF?

  • If the recombinant arnF alters antibiotic resistance profiles, additional containment may be required (particularly if it could compromise treatment of diseases)

  • Expression in non-K12 E. coli strains (such as B cells) may require BSL-1 containment under NIH guideline section III-E

  • Large-scale cultures (>10 liters) would require BSL1-LS designation and additional oversight

All recombinant DNA work, even if exempt from certain NIH guidelines, generally requires Institutional Biosafety Committee (IBC) registration and approval .

How does the expression of recombinant arnF affect host E. coli metabolism?

Recent research indicates that the metabolic burden imposed by recombinant protein expression, including membrane proteins like arnF, is not primarily due to energy limitations as traditionally believed, but rather stems from the accumulation of ATP and glycolysis precursors . This can lead to metabolic imbalance and growth inhibition.

Key metabolic impacts include:

  • Competition for ribosomes between host and recombinant protein synthesis, potentially triggering stress responses

  • Significant variation in host response depending on E. coli strain lineage (B strains versus K12 strains)

  • Potential accumulation of noncanonical amino acids during high-density fermentation, with higher rates of misincorporation observed in K12-type strains compared to BL21(DE3)

Research has demonstrated two contrasting hypotheses about expression system toxicity:

  • One view suggests that excessive amounts of recombinant mRNA outcompete endogenous mRNA for limited ribosomes, impairing essential protein synthesis

  • An alternative perspective proposes that inhibition of host physiological metabolism leads to bacterial decline, with adaptations occurring through mutations affecting T7 RNA polymerase activity

What experimental approaches can be used to study arnF's role in antimicrobial resistance?

The study of arnF's contribution to antimicrobial resistance can be approached through several methodologies:

  • Gene knockout and complementation studies: Generate arnF deletion mutants and measure changes in minimum inhibitory concentrations (MICs) for relevant antimicrobials, followed by complementation with recombinant arnF to confirm phenotype restoration

  • Membrane fraction isolation and flippase activity assays: Isolate bacterial membrane fractions containing native or recombinant arnF to measure translocation of labeled 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol substrates

  • Structural biology approaches: Use techniques like X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of arnF and identify potential antimicrobial binding sites

  • Proteomic analysis: Employ two-dimensional gel electrophoresis (2DE) combined with mass spectrometry to examine arnF expression under antibiotic stress conditions, similar to approaches used for other E. coli stress responses

  • Transcriptomic analysis: Use RNA-Seq to analyze expression patterns of arnF and related genes under various growth conditions and antibiotic exposures, which would help identify regulatory mechanisms

How does homologous recombination affect the stability of recombinant arnF expression systems?

The stability of recombinant constructs in E. coli is significantly influenced by homologous recombination processes. Research has shown that the entire basic genome of E. coli is continually exchanged through homologous recombination with genomic fragments acquired from other strains in the population . This presents specific challenges for maintaining stable arnF expression:

  • Recombinant transfers are pervasive across the basic genome, particularly between genomes in the same evolutionary group

  • Many recombinant transfers appear to incorporate fragments of entering DNA produced by restriction systems of the recipient cell, which could affect plasmid stability

  • A computational model from Panos et al. suggests that most recombinant transfers likely occur through generalized transduction by coevolving phage populations, which could redistribute genetic material throughout bacterial genomes

For long-term expression studies, researchers should implement strategies to minimize recombination events, such as:

  • Using recA-deficient host strains

  • Monitoring plasmid stability through regular sequencing

  • Implementing selection pressure to maintain recombinant constructs

  • Considering the potential impact of phage contamination on culture stability

What methodologies are most effective for studying the role of arnF in the broader Arn pathway?

The arnF protein functions as part of a multiprotein complex in the Arn pathway. To understand its role:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation using tagged arnF to identify binding partners

    • Bacterial two-hybrid assays to map specific interaction domains

    • Crosslinking mass spectrometry to capture transient interactions

  • In vivo membrane topology mapping:

    • PhoA/LacZ fusion analysis to determine membrane topology

    • Cysteine accessibility methods to probe transmembrane segment organization

    • Fluorescence microscopy with GFP-tagged arnF to determine cellular localization

  • Reconstitution in proteoliposomes:

    • Purification of recombinant arnF and reconstitution in artificial membrane systems

    • Development of in vitro flippase assays using fluorescently labeled substrates

    • Measurement of substrate translocation rates under various conditions

  • Integration with structural biology approaches:

    • Cryo-electron microscopy of the entire Arn pathway complex

    • Targeted mutagenesis based on structural predictions to identify functional residues

How can RecQ helicase activity impact the stability and expression of recombinant arnF constructs?

RecQ helicase plays a significant role in DNA metabolism that can affect recombinant constructs. E. coli RecQ processes stalled replication forks and participates in SOS signaling, which can influence the stability of recombinant plasmids expressing proteins like arnF .

Key considerations include:

  • RecQ binds and unwinds forked DNA substrates with gaps on the leading strand more efficiently than other DNA structures, potentially affecting plasmid replication

  • The helicase generates single-stranded DNA gaps that can recruit RecA for SOS induction and recombination at stalled replication forks

  • In strains with DNA polymerase III mutations (dnaE486), RecQ deletion suppresses SOS induction and filamentation, but leads to the appearance of anucleate cells, suggesting RecQ's role in maintaining genome integrity during replication stress

For optimal arnF expression, consider:

  • The potential impact of recombination events on plasmid stability

  • How replication stress might trigger RecQ-dependent responses

  • Whether high-copy plasmids might induce SOS responses through RecQ activity

  • Implementation of RecA- strains for increased plasmid stability in long-term cultures

What are the critical quality control parameters for verifying recombinant arnF function?

When producing recombinant arnF, several quality control parameters should be assessed:

  • Protein purity and integrity:

    • Minimum purity threshold of >90% as determined by SDS-PAGE

    • Verification of expected molecular weight (approximately 15-16 kDa for arnF)

    • Mass spectrometry confirmation of intact protein sequence

  • Membrane integration:

    • Verification of proper membrane localization using subcellular fractionation

    • Assessment of topology using protease accessibility assays

  • Functional activity:

    • Development of flippase activity assays using fluorescently labeled substrates

    • Complementation of arnF-deficient strains to restore phenotype

  • Storage stability:

    • Determination of optimal buffer conditions (typically Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

    • Assessment of protein stability after freeze-thaw cycles

    • Addition of 5-50% glycerol for long-term storage at -20°C/-80°C

How can contradictions in recombinant protein expression data for membrane proteins like arnF be resolved?

Research on recombinant membrane protein expression frequently presents contradictory results. For arnF, the following approaches can help resolve inconsistencies:

  • Systematic strain comparison:

    • Compare expression in multiple E. coli strains (B vs. K12 lineages)

    • Test various expression vectors with different promoter strengths

    • Examine effects of codon optimization on expression levels

  • Analysis of metabolic burden:

    • Measure growth rates, final cell densities, and metabolite accumulation

    • Analyze ATP levels and glycolytic intermediate accumulation

    • Compare protein misfolding and inclusion body formation rates

  • Expression tuning strategies:

    • Test expression at various temperatures (16°C, 25°C, 30°C, 37°C)

    • Implement auto-induction media versus IPTG induction

    • Explore dual-control expression systems that decouple cell growth from recombinant protein production

Recent research has highlighted contradictory explanations for expression toxicity:

  • Some studies suggest that cells stressed by high recombinant expression either die or accumulate mutations reducing T7 RNA polymerase activity

  • Others propose that inhibition of host physiological metabolism is the primary issue

Resolution of these contradictions requires standardized experimental conditions and reporting parameters across labs.

What approaches can be used to study the interaction between arnF and the bacterial immune response?

Studying how arnF affects bacterial immune responses requires multiple experimental approaches:

  • Transcriptomic profiling:

    • RNA-Seq analysis comparing wild-type versus arnF-overexpressing or arnF-deleted strains

    • Examination of differential gene expression under antimicrobial exposure

  • SOS response monitoring:

    • Similar to RecQ studies, measure LexA degradation as an indicator of SOS induction

    • Use reporter systems like UmuC-LacZ fusion to quantify SOS response activation

  • Stress response characterization:

    • Analyze expression of key stress proteins via proteomic approaches

    • Evaluate membrane integrity under various stress conditions

  • Immunological studies:

    • Assess how arnF-mediated LPS modifications affect recognition by host immune factors

    • Measure changes in inflammatory responses to arnF-modified versus unmodified bacteria

The E. coli multiomics approach employed by Ruiz et al. provides a template for comprehensive analysis, combining:

  • Whole-genome sequencing to identify genetic features

  • RNA-Seq for transcriptome analysis

  • Two-dimensional gel electrophoresis for proteome mapping

What are the specific challenges in purifying functional arnF protein and how can they be addressed?

Purification of membrane proteins like arnF presents several technical challenges:

ChallengeCauseSolution Strategy
Low expression levelsToxicity of membrane protein overexpressionUse C41/C43 E. coli strains specifically designed for membrane protein expression
Protein aggregationHydrophobic nature of transmembrane domainsInclude appropriate detergents during extraction (DDM, LDAO, or OG)
Loss of native conformationDetergent-induced structural changesTry nanodisc or styrene maleic acid copolymer (SMA) approaches to maintain lipid environment
Difficulty in assessing functionalityLack of simple activity assays for flippasesDevelop fluorescence-based translocation assays with labeled substrates
Protein instabilityLoss of structural integrity during purificationInclude stabilizing agents (glycerol, specific lipids) in purification buffers

Additionally, recent advances in E. coli recombinant protein production suggest:

  • Consideration of codon optimization specifically for membrane proteins

  • Exploration of fusion partners that enhance membrane protein folding

  • Implementation of controlled expression systems to balance protein production with cell growth

How can researchers troubleshoot inconsistent expression of recombinant arnF across different laboratories?

Inconsistent results between laboratories can be addressed through systematic troubleshooting:

  • Standardize expression conditions:

    • Establish precise protocols for media composition, temperature, and induction parameters

    • Implement standard reference strains and plasmids for cross-laboratory comparison

    • Define benchmarks for "successful" expression (yield, purity, activity)

  • Control for genetic stability:

    • Regular sequencing of expression constructs to detect mutations

    • Monitor for population heterogeneity that might arise during culture

    • Consider the impact of homologous recombination on plasmid stability

  • Address technical variations:

    • Standardize cell lysis and membrane protein extraction methods

    • Implement consistent purification strategies

    • Establish uniform quality control metrics

  • Consider strain-specific effects:

    • The significant differences in glucose metabolism between K12 and B E. coli strains affect recombinant protein quality

    • Higher rates of noncanonical amino acid misincorporation occur in K12-type HMS174(DE3) bacteria compared to BL21(DE3)

    • Starting with robust BL21(DE3) strains may provide more consistent results across laboratories

How can researchers leverage the NIH Guidelines classification system for recombinant arnF research?

Navigating the regulatory framework for recombinant DNA research requires understanding how arnF work is classified:

  • Determine appropriate NIH Guidelines section:

    • Expression in E. coli K12 with standard vectors typically falls under III-F, Appendix C-II (Exempt, BSL1)

    • Expression in non-K12 E. coli (e.g., BL21) falls under III-E (BSL1)

    • Large-scale cultures (>10 liters) would be classified under III-D-6 (BSL1-LS)

  • Implement appropriate containment measures:

    • BSL1 practices for most arnF expression work

    • Consider enhanced measures if working with pathogenic strains or when arnF expression might affect antimicrobial resistance profiles

  • Documentation requirements:

    • Maintain detailed records of experimental design, risk assessment, and containment measures

    • Prepare appropriate documentation for Institutional Biosafety Committee review

  • Special considerations:

    • If arnF function in antimicrobial resistance is being studied, evaluation under Section III-A-1 may be necessary (if it could compromise ability to treat disease)

    • Research combining arnF with potential pathogenicity factors should be carefully evaluated

By properly classifying recombinant arnF research, investigators can ensure compliance while implementing appropriate safety measures for their specific experimental design.

How does arnF contribute to the antimicrobial resistance mechanisms in pathogenic E. coli strains?

The arnF protein is part of the Arn pathway that modifies lipopolysaccharide structure through the addition of 4-amino-4-deoxy-L-arabinose to lipid A, which can decrease the net negative charge of the bacterial outer membrane and reduce binding of cationic antimicrobial peptides and certain antibiotics.

Research approaches to elucidate arnF's specific contribution include:

  • Comparative genomics of susceptible versus resistant E. coli strains to identify arnF sequence variations

  • Analysis of arnF expression in response to antimicrobial exposure

  • Structural studies of how arnF-mediated LPS modifications alter antimicrobial binding

  • Investigation of regulatory mechanisms controlling arnF expression under stress conditions

Multiomics assessment similar to that performed by Ruiz et al. can provide insights into how arnF expression correlates with other resistance mechanisms in clinical isolates . Their work demonstrated that genes related to antibiotic resistance, including those involved in membrane modification, can be identified through whole-genome sequencing and correlated with proteomic data to establish functional relationships .

What are the evolutionary implications of homologous recombination for arnF diversity among E. coli strains?

Research has demonstrated that the entire basic genome of E. coli is continually exchanged through homologous recombination with genomic fragments acquired from other genomes in the population . This has significant implications for arnF diversity:

  • Recombinant transfer appears pervasive across the E. coli basic genome, primarily between genomes in the same evolutionary group

  • Many unique mosaic patterns are generated through this process, potentially leading to functional diversity in proteins like arnF

  • The six least-diverged genome pairs show one or two recombinant transfers of length ~40-115 kbp, each containing gene clusters that confer selective advantages in specific environments

  • Variable gene clusters can be exchanged by homologous recombination because the sequences flanking them are much less variable

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.