YciB is integral to cell envelope synthesis and division in E. coli:
Interaction with division machinery: Directly binds ZipA, a key cell division protein, influencing septum localization and cell length regulation. Deletion of yciB shortens cell length, while overexpression causes elongation .
Membrane integrity: The ΔyciB mutant exhibits sensitivity to low osmolarity, indicating its role in maintaining cell envelope stability .
Lipoprotein translocation: While YciB itself is not a lipoprotein, related studies on E. coli membrane proteins (e.g., LolA) suggest YciB may indirectly assist in membrane protein trafficking .
Recombinant YciB is used to dissect its role in the divisome complex. Key findings include:
ZipA interaction: Purified YciB binds ZipA independently of PBP3, suggesting a novel regulatory pathway in septum formation .
Membrane topology: Structural studies confirm five transmembrane helices, positioning key residues for protein-protein interactions .
Studies using ΔyciB mutants highlight its importance during osmotic stress, linking it to peptidoglycan remodeling pathways .
KEGG: ecx:EcHS_A1363
YciB (probable intracellular septation protein A) is an inner membrane protein in Escherichia coli that plays a significant role in cell division processes. Research has demonstrated that YciB is involved in cell envelope synthesis and septum formation. Deletion of the yciB gene results in shorter cell length compared to wild type E. coli, while overexpression causes cell elongation, indicating its critical role in determining bacterial cell morphology . YciB directly interacts with ZipA, an essential protein for cell division, suggesting it participates in cell envelope synthesis directed by ZipA in a PBP3-independent manner . This interaction highlights YciB's importance in coordinating proper septum formation during bacterial cytokinesis.
YciB is a full-length protein consisting of 179 amino acids (1-179aa). According to sequence analysis, it is a membrane-spanning protein with hydrophobic regions consistent with its localization to the inner membrane of E. coli . The amino acid sequence (MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVVFGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLNLAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS) reveals characteristic features of membrane proteins, including transmembrane domains that anchor it to the bacterial inner membrane . This structure facilitates its interaction with other proteins involved in the cell division process, such as ZipA.
Recombinant YciB protein can be obtained through commercial sources or by expressing it in laboratory settings. Commercial vendors offer purified recombinant YciB with various tags, such as His-tagged versions, which facilitate purification and detection in experiments . Alternatively, researchers can produce the protein by cloning the yciB gene into an appropriate expression vector and expressing it in E. coli expression systems. The choice of expression system significantly impacts protein yield and quality. When designing your own expression system, it's important to consider factors such as promoter strength, vector copy number, and host strain characteristics to optimize production .
For membrane proteins like YciB, the choice of expression system is crucial for obtaining properly folded, functional protein. E. coli expression systems are commonly used due to their simplicity and high yield potential . Research indicates that balancing promoter strength and plasmid copy number is essential for optimal expression. High copy number vectors combined with strong promoters can create metabolic burden, leading to decreased protein production . For YciB expression, medium copy number vectors (such as those with p15A origin, ~10 copies/cell) often perform better than high copy number vectors (like pMB1 origin, 500-700 copies/cell) . Additionally, the choice between promoters such as T7, tac, trc, or BAD should be carefully considered, as each offers different expression characteristics and induction control mechanisms.
Purification of membrane proteins like YciB presents unique challenges due to their hydrophobic nature. Affinity chromatography using tagged versions of YciB (typically His-tagged) is the most common initial purification step . For optimal results, a multi-step purification protocol is recommended: 1) Cell lysis using mild detergents that maintain protein folding and activity; 2) Membrane fraction isolation through differential centrifugation; 3) Solubilization using appropriate detergents; 4) Affinity chromatography (e.g., Ni-NTA for His-tagged proteins); 5) Size exclusion chromatography to remove aggregates and impurities. Throughout this process, it's crucial to maintain conditions that preserve protein structure and activity, including appropriate buffer composition, pH, and detergent concentration. Protein purity should be assessed using SDS-PAGE, with successful preparations typically achieving greater than 90% purity .
Optimizing solubility of membrane proteins like YciB requires careful consideration of expression conditions. Research has shown that the formation of inclusion bodies and protein precipitation are common challenges in E. coli expression systems, resulting from high expression rates, incorrect folding, aggregation, or insufficient chaperone activity . Several strategies can enhance solubility: 1) Lower induction temperature (16-25°C) to slow down protein synthesis and facilitate proper folding; 2) Reduced inducer concentration to moderate expression rate; 3) Selection of appropriate promoter-origin combinations—for example, weaker promoters like BAD show lower insoluble fraction compared to stronger promoters ; 4) Co-expression with molecular chaperones to assist in proper folding; 5) Addition of solubility-enhancing fusion tags; 6) Optimization of growth media composition and culture conditions. Monitoring soluble versus insoluble fractions through SDS-PAGE analysis is essential to evaluate the effectiveness of these strategies .
YciB directly interacts with ZipA, an essential component of the bacterial cell division machinery . This interaction can be studied using multiple complementary approaches. In vitro methods include pull-down assays with purified proteins, surface plasmon resonance (SPR), and isothermal titration calorimetry (ITC) to measure binding kinetics and thermodynamics. For pull-down assays, one protein (typically the His-tagged YciB) is immobilized on a resin, and binding of the partner protein (ZipA) is detected by Western blotting. In vivo approaches include bacterial two-hybrid systems, co-immunoprecipitation, and fluorescence resonance energy transfer (FRET) using fluorescently labeled proteins. To visualize the cellular localization of this interaction, immunofluorescence microscopy with antibodies against both proteins can be performed, or fluorescent protein fusions can be created to track their subcellular distribution. The disruption of ZipA septum localization in ΔyciB mutants suggests that YciB may play a role in proper ZipA positioning during cell division .
Several phenotypic assays can effectively demonstrate YciB's role in cell division: 1) Cell morphology analysis using phase contrast microscopy to measure cell length and width in wild-type, ΔyciB mutant, and yciB-overexpressing strains ; 2) Time-lapse microscopy to observe division dynamics and septum formation; 3) Fluorescent D-amino acid (FDAA) labeling to visualize peptidoglycan synthesis patterns; 4) Membrane staining with fluorescent dyes like FM4-64 to examine septum positioning; 5) Growth rate measurements to assess division frequency; 6) Antibiotic sensitivity assays, particularly to cell wall-targeting antibiotics; 7) Genetic interaction studies with other cell division gene mutations. These assays collectively provide a comprehensive view of YciB's function in bacterial cell division. The observation that ΔyciB mutants are shorter than wild-type cells while overexpression causes elongation provides clear evidence of YciB's role in controlling bacterial cell length during division .
Distinguishing between direct and indirect effects of YciB on cell division requires a multi-faceted experimental approach. First, complementation studies are essential—phenotypes of ΔyciB mutants should be rescued by expressing wild-type YciB but not by mutant versions lacking key functional domains. Second, structure-function analysis using site-directed mutagenesis to identify critical residues that affect specific interactions or functions can help map direct effects. Third, timing studies using inducible expression systems can differentiate between immediate (likely direct) and delayed (possibly indirect) effects following YciB expression. Fourth, in vitro reconstitution experiments with purified components can confirm direct biochemical activities. Fifth, proximity labeling techniques like BioID can identify proteins in close physical proximity to YciB in vivo. Finally, systematic analysis of genetic interactions through synthetic genetic arrays can reveal functional relationships with other cell division proteins. When combined, these approaches provide robust evidence for distinguishing direct YciB functions from secondary effects.
Metabolic burden represents a significant challenge in recombinant protein expression, including YciB production. This burden arises when cellular resources are diverted to produce foreign proteins, leading to growth inhibition and reduced product yield . In E. coli expression systems, several factors contribute to metabolic burden, including plasmid maintenance, transcription and translation of foreign genes, and protein folding requirements. Research demonstrates that high copy number vectors combined with strong promoters create significant metabolic imbalance, resulting in decreased recombinant protein production .
To mitigate metabolic burden when expressing YciB: 1) Balance plasmid copy number with promoter strength—medium copy vectors (p15A origin) often yield better results than high copy vectors (pMB1 origin) when using strong promoters ; 2) Select appropriate promoter systems based on desired expression levels—for example, the BAD promoter with high copy plasmids may perform better than stronger promoters like tac or trc due to its weaker strength ; 3) Optimize induction conditions, including inducer concentration and timing; 4) Consider using strains with enhanced metabolic capacity or deleted competing pathways; 5) Implement fed-batch cultures to maintain optimal growth conditions. Tuning these parameters can significantly improve YciB yield and quality by reducing the negative effects of metabolic burden.
Investigating YciB's role in PBP3-independent cell envelope synthesis requires specialized experimental approaches. First, comparative peptidoglycan analysis using HPLC or mass spectrometry can detect differences in cell wall composition between wild-type, ΔyciB mutants, and strains with PBP3 inhibition. Second, localization studies using fluorescently tagged YciB and ZipA in the presence of PBP3 inhibitors (like aztreonam) can reveal whether YciB-ZipA complexes form independently of PBP3 activity . Third, in vitro peptidoglycan synthesis assays with purified components can test if YciB-ZipA complexes directly influence cell wall synthesis. Fourth, bacterial two-hybrid or pull-down assays can identify if YciB interacts with other peptidoglycan synthesis enzymes beyond PBP3. Fifth, transcriptomic and proteomic profiling of ΔyciB mutants can reveal changes in expression of other cell envelope synthesis genes, providing insight into compensatory pathways. Sixth, cell wall labeling using D-amino acid fluorophores with super-resolution microscopy can visualize the spatial pattern of peptidoglycan insertion in the absence of YciB or PBP3. Together, these approaches can elucidate YciB's specific contribution to PBP3-independent cell envelope synthesis pathways .
The function and localization of YciB in E. coli likely varies with growth conditions, reflecting the bacterium's adaptability to different environments. To investigate this relationship, researchers should employ several complementary approaches: 1) Fluorescence microscopy of YciB-fluorescent protein fusions under various growth conditions (different carbon sources, growth phases, stress conditions) to track changes in subcellular localization; 2) Quantitative proteomics to measure YciB expression levels across growth conditions; 3) Phenotypic analysis of ΔyciB mutants under diverse conditions to identify environment-specific defects; 4) Co-immunoprecipitation studies to detect condition-dependent protein interactions; 5) Chromatin immunoprecipitation sequencing (ChIP-seq) of transcription factors that might regulate yciB expression under different conditions. Growth in minimal versus rich media, aerobic versus anaerobic conditions, different carbon sources (glucose versus glycerol), and various stress conditions (osmotic, pH, antibiotic) should be systematically compared. These experiments would reveal how YciB function adapts to environmental changes and provide insight into its regulatory network within bacterial cell division processes.
Distinguishing YciB-specific phenotypes from general cell division defects requires careful experimental design: 1) Genetic complementation—the ΔyciB phenotype should be specifically rescued by wild-type yciB expression but not by overexpression of other division genes; 2) Timing analysis—determine whether yciB deletion affects early or late stages of division through time-lapse microscopy; 3) Epistasis analysis—construct double mutants of yciB with other division genes to determine pathway relationships; 4) Localization dependency—examine whether YciB localization depends on other division proteins and vice versa; 5) Specific interaction assays—identify the unique protein interaction network of YciB compared to other division proteins; 6) Conditional mutants—use temperature-sensitive or inducible systems to observe immediate effects of YciB depletion versus long-term adaptations; 7) Cross-species complementation—test whether YciB homologs from related bacteria can rescue E. coli ΔyciB phenotypes. Additionally, detailed morphological analysis focusing on parameters like cell length (which is shorter in ΔyciB mutants compared to wild-type cells), division site positioning, and membrane invagination patterns can reveal YciB-specific characteristics distinct from phenotypes caused by other division defects .
Several cutting-edge technologies show promise for elucidating YciB function: 1) Cryo-electron microscopy (cryo-EM) for high-resolution structural analysis of YciB alone and in complex with interaction partners like ZipA; 2) Super-resolution microscopy techniques (PALM, STORM, SIM) to visualize YciB localization and dynamics with nanometer precision during cell division; 3) CRISPR interference (CRISPRi) for tunable, targeted reduction of yciB expression to study dose-dependent effects; 4) Proximity-dependent biotin labeling (BioID, TurboID) to map the complete YciB protein interaction network in living cells; 5) Microfluidic single-cell analysis to track division dynamics in ΔyciB mutants with high temporal resolution; 6) Native mass spectrometry to characterize YciB complexes in their membrane environment; 7) Molecular dynamics simulations to model YciB membrane insertion and protein interactions; 8) High-throughput genetic interaction mapping using transposon sequencing (Tn-seq) to identify synthetic lethal or synthetic rescue relationships with yciB; 9) In vitro reconstitution of minimal division systems incorporating purified YciB to define its biochemical activities. These technologies, particularly when used in combination, could significantly advance our mechanistic understanding of YciB's role in bacterial cell division.
YciB research holds significant potential for novel antimicrobial development through several avenues: 1) As a previously underexplored division protein, YciB represents a new potential target for antibiotics with mechanisms distinct from existing drugs; 2) The direct interaction between YciB and ZipA, both essential for proper cell division, could be targeted by small molecule inhibitors that disrupt this protein-protein interaction ; 3) Structural studies of YciB could enable structure-based drug design of specific inhibitors; 4) Understanding YciB's role in PBP3-independent cell envelope synthesis might reveal bypass mechanisms that bacteria use to resist β-lactam antibiotics, leading to combination therapies that block multiple pathways ; 5) Species-specific differences in YciB structure or function could potentially be exploited for narrow-spectrum antibiotics with reduced impact on beneficial microbiota; 6) Knowledge of how YciB contributes to cell morphology could lead to drugs that don't immediately kill bacteria but instead disrupt their morphogenesis, potentially creating synergies with the immune system or other antibiotics. The essential nature of bacterial cell division makes proteins like YciB valuable targets in the ongoing search for new approaches to combat antimicrobial resistance.
The evolutionary conservation of YciB across bacterial species presents intriguing research opportunities: 1) Comparative genomic analysis can reveal whether YciB is universally conserved or exhibits lineage-specific patterns, indicating its evolutionary importance; 2) Sequence conservation analysis can identify critical functional domains that have remained unchanged through evolutionary history; 3) Heterologous expression studies testing whether YciB from one species can complement ΔyciB mutations in another species would reveal functional conservation; 4) Investigation of co-evolution between YciB and its interaction partners, particularly ZipA, could uncover linked evolutionary trajectories ; 5) Analysis of YciB in bacterial species with unusual cell division mechanisms might reveal specialized adaptations; 6) Examination of horizontal gene transfer patterns for yciB and surrounding genomic regions could indicate whether it has been subject to selection pressure from mobile genetic elements; 7) Reconstruction of ancestral YciB sequences through phylogenetic analysis could provide insight into the protein's original functions and subsequent specializations. These evolutionary studies would not only enhance our fundamental understanding of bacterial cell division but might also reveal species-specific vulnerabilities that could be exploited for targeted antimicrobial development.