Recombinant Escherichia coli O9:H4 Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

Recombinant Escherichia coli O9:H4 Prolipoprotein diacylglyceryl transferase (Lgt) is a membrane-bound enzyme (UniProt ID: A8A3W1) essential for bacterial viability. It catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins, forming thioether-linked diacylglyceryl-prolipoprotein . This modification is the first step in lipoprotein maturation, enabling subsequent processing by signal peptidase II (LspA) and apolipoprotein N-acyltransferase (Lnt) .

2.1. Sequence and Expression

  • Source: Escherichia coli O9:H4 (strain HS) .

  • Expression System: Mammalian cells .

  • Sequence: Partial protein spanning residues 1–291 (predicted molecular weight: ~33 kDa) .

  • Key Domains: Seven transmembrane segments, periplasm-facing N-terminus, cytoplasm-facing C-terminus .

Table 1: Key Properties of Recombinant Lgt

PropertyDetails
Expression TagDetermined during production (commonly polyhistidine or GST)
Purity>85% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C
ActivityEC 2.4.99.-; requires phosphatidylglycerol as a substrate

2.2. Critical Residues

Mutational studies identified essential residues for enzymatic activity:

  • Y26, N146, G154: Absolute requirement for function .

  • R143, E151, R239, E243: Important for substrate binding or catalysis .

3.1. Enzymatic Mechanism

Lgt operates on the outer leaflet of the inner membrane, utilizing a conserved "Lgt signature motif" facing the periplasm . Structural studies reveal its interaction with phosphatidylglycerol and prolipoprotein substrates through hydrophobic pockets .

3.2. Antibiotic Target Potential

  • Depletion Effects: Partial Lgt inhibition (≥25%) disrupts outer membrane integrity, increasing sensitivity to serum killing and antibiotics (e.g., azithromycin, rifampicin) .

  • Genetic Studies: E. coli CFT073 Δlgt strains exhibit attenuated virulence in murine infection models .

Table 2: Phenotypic Changes in E. coli Upon Lgt Depletion

ParameterObservation
Outer Membrane IntegrityIncreased SYTOX green permeability
Antibiotic SensitivityEnhanced susceptibility to β-lactams
Cell MorphologyEnlarged cell size, inner membrane contraction

Applications in Research

  1. Enzymology Studies: Used to reconstitute lipoprotein modification pathways in vitro .

  2. Antibiotic Development: Target validation for inhibitors like G2824, which blocks Lgt activity and shows bactericidal effects against Acinetobacter baumannii and E. coli .

  3. Protein Interaction Mapping: Identifies binding partners in lipoprotein biogenesis .

Challenges and Future Directions

  • Structural Limitations: Full-length E. coli Lgt remains uncharacterized crystallographically.

  • Inhibitor Optimization: Current Lgt inhibitors lack broad-spectrum activity, necessitating further chemical modifications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
lgt; EcHS_A2974; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein Diacylglyceryl Transferase (Lgt) and what role does it play in bacterial physiology?

Lipoprotein diacylglyceryl transferase (Lgt) is a membrane-integral enzyme that catalyzes the first step in bacterial lipoprotein biogenesis. It transfers a diacylglyceryl (DAG) moiety from a phospholipid, typically phosphatidylglycerol (PG), to a conserved cysteine residue in the membrane-anchored signal peptide of a preprolipoprotein. This transfer occurs via a thioether bond, producing a proBLP that becomes doubly anchored in the membrane. This modification is essential for proper lipoprotein processing and localization in the bacterial cell envelope .

Lipoproteins serve myriad functions crucial for bacterial survival, including roles in cell envelope integrity, nutrient acquisition, virulence, and immune signaling. In Gram-negative bacteria like E. coli, Lgt works in concert with two other enzymes - Lipoprotein signal peptidase (LspA) and Lipoprotein N-acyl transferase (Lnt) - to complete the post-translational processing of lipoproteins. The canonical pathway begins with Lgt-mediated diacylglyceryl transfer, followed by signal peptide cleavage by LspA, and finally N-acylation by Lnt .

How is Lgt activity measured in laboratory settings?

Lgt enzymatic activity can be measured using several methodological approaches:

  • Glycerol phosphate release assay: This in vitro assay measures the release of glycerol phosphate, a byproduct of the Lgt-catalyzed transfer reaction. When Lgt transfers the diacylglyceryl moiety from phosphatidylglycerol to a peptide substrate, glycerol phosphate is released. Since phosphatidylglycerol substrates typically contain a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released. The detection of G3P is commonly achieved through a coupled luciferase reaction system .

  • Peptide substrate modification: Researchers often use synthetic peptides derived from known lipoproteins (such as Pal-IAAC, where C is the conserved cysteine modified by Lgt) to assess Lgt activity. The transfer of diacylglyceryl to these peptides can be monitored using various analytical techniques .

  • TLC-based assays: Thin-layer chromatography (TLC) provides a direct method for quantifying Lgt activity. Fluorescently labeled substrates can be visualized on TLC plates, and the conversion of substrate to product can be quantified by image analysis .

What expression systems are most effective for producing recombinant Lgt?

For expression of recombinant Lgt from E. coli O9:H4, heterologous expression in E. coli strains optimized for membrane protein production has proven effective. The following methodological considerations are important:

  • Vector selection: Expression vectors containing inducible promoters (such as T7) with appropriate tags (typically hexahistidine tags) facilitate controlled expression and purification.

  • Expression conditions: Lower temperatures (16-25°C) and reduced inducer concentrations often improve the yield of functional Lgt by allowing proper membrane insertion and folding.

  • Membrane fraction isolation: Since Lgt is a membrane integral protein, specialized protocols for membrane protein extraction using detergents are necessary.

  • Purification approach: Affinity chromatography using immobilized metal affinity chromatography (IMAC) followed by size-exclusion chromatography has been successful for obtaining purified Lgt suitable for biochemical and structural studies .

  • Storage considerations: Purified recombinant Lgt is typically stored in Tris-based buffers with 50% glycerol at -20°C or -80°C. Repeated freeze-thaw cycles should be avoided to maintain enzyme activity .

What structural features of Lgt are critical for its catalytic function?

The structural analysis of Lgt has revealed several critical features that underpin its catalytic mechanism:

  • Transmembrane architecture: Lgt is an integral membrane protein with multiple transmembrane helices that form a distinct active site accessible from the periplasmic side of the membrane in Gram-negative bacteria.

  • Active site residues: Histidine residues, particularly H85 and H153 (in B. cereus Lgt), have been identified as essential for catalytic activity. Mutation of these residues results in significant loss of enzymatic function .

  • Substrate binding pocket: The active site contains a hydrophobic cavity that accommodates the diacylglyceryl moiety of phosphatidylglycerol, with specific residues oriented to facilitate the nucleophilic attack by the thiol group of the conserved cysteine in the lipobox.

  • Stereoselectivity: Lgt demonstrates specificity for the (R)-stereoisomer of diacylglyceryl, being inactive with the (S)-stereoisomer. This stereoselectivity is critical for proper substrate recognition and catalysis .

  • Substrate access channel: A membrane-facing fenestration between transmembrane helices (particularly between M3 and M4 in the B. cereus Lgt) allows substrate entry and product exit, essential for the transacylation reaction .

The integration of structural data with biochemical analyses suggests a direct transfer mechanism rather than an acylated enzyme intermediate mechanism, highlighting the precise molecular choreography required for this critical modification.

How do Lgt inhibitors function, and what are the challenges in their development?

Lgt inhibitors represent a promising class of potential antibacterial compounds that target this essential enzyme. Recent research has identified several key aspects of Lgt inhibition:

  • Mechanism of action: The first identified Lgt inhibitors (such as compounds G9066, G2823, and G2824) potently inhibit Lgt biochemical activity with IC₅₀ values ranging from 0.18 to 0.93 μM. These inhibitors appear to interfere with the diacylglyceryl transferase reaction, possibly by binding to the phosphatidylglycerol binding site .

  • Cellular effects: Lgt inhibition leads to the accumulation of prolipoprotein forms, particularly evident when analyzing Lpp (the major outer membrane lipoprotein) processing by Western blot. Treatment with Lgt inhibitors results in accumulation of a ~14 kDa Lpp isoform in the inner membrane, which may represent a stable Lpp dimer .

  • Resistance mechanisms: Unlike inhibitors targeting other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein lpp is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors. This suggests that Lgt inhibitors may be less susceptible to this common resistance mechanism .

  • Development challenges: A significant challenge in Lgt inhibitor development is the difficulty in raising on-target resistant mutants. This may be because the inhibitors bind to highly conserved regions where mutations would likely result in loss of essential Lgt function leading to cell death, similar to what has been observed with globomycin inhibition of LspA .

What methodological approaches are most effective for analyzing Lgt substrate specificity?

Analyzing Lgt substrate specificity requires sophisticated experimental approaches:

  • Synthetic peptide libraries: Using peptide substrates with variations in the lipobox sequence (the conserved [LVI][ASTVI][GAS]C motif) allows for detailed analysis of amino acid preferences at positions surrounding the conserved cysteine.

  • Phospholipid variant assays: While phosphatidylglycerol is the preferred lipid donor, systematic testing with different phospholipids helps determine the lipid specificity of Lgt.

  • Direct biochemical assays: TLC-based assays using fluorescently labeled substrates provide direct quantification of substrate conversion rates, enabling comparative analysis of substrate preference .

  • NMR spectroscopy: Nuclear magnetic resonance (NMR) spectroscopy allows precise identification of reaction products and determination of which acyl chain is transferred during the reaction. This technique has confirmed that Lgt transfers the acyl chain at the sn-2 position on the glyceryl of the substrate .

  • pH dependency studies: Optimal Lgt activity occurs in the pH range of 4.4 to 5.4, providing insights into the catalytic mechanism and physiological conditions required for enzyme function .

What phenotypic effects result from Lgt depletion or inhibition in bacterial cells?

Lgt depletion or inhibition produces several distinct phenotypic effects with significant implications for bacterial physiology:

  • Outer membrane permeabilization: Loss of Lgt function leads to destabilization of the outer membrane, resulting in increased permeability to external compounds.

  • Enhanced antibiotic sensitivity: Bacteria with depleted or inhibited Lgt show increased susceptibility to various antibiotics, likely due to compromised membrane barrier function.

  • Serum sensitivity: Lgt-depleted bacteria demonstrate enhanced sensitivity to serum killing, highlighting the importance of properly processed lipoproteins in resisting host immune defenses .

  • Altered lipoprotein processing: Western blot analysis reveals the accumulation of unprocessed prolipoprotein forms, confirming that downstream processing by LspA and Lnt is dependent on prior Lgt-mediated diacylglyceryl modification .

  • Peptidoglycan linkage impairment: The lack of diacylglyceryl modification by Lgt generates a less optimal substrate for L,D-transpeptidases that covalently link lipoproteins (such as Lpp) to peptidoglycan, affecting cell envelope integrity .

These combined effects make Lgt an attractive antibacterial target, as its inhibition impacts multiple aspects of bacterial cell envelope function simultaneously.

What are the optimal conditions for Lgt enzymatic assays?

Based on experimental data, the following conditions optimize Lgt enzymatic activity in vitro:

ParameterOptimal ConditionNotes
pH4.4-5.4Activity decreases significantly outside this range
Temperature37°CStandard for E. coli enzyme activity
Substrate stereochemistry(R)-stereoisomer of DAGEnzyme is inactive with (S)-stereoisomer
Incubation time30 minutesFor standard activity measurements
DetergentDependent on specific assayCritical for maintaining enzyme in active conformation
Buffer systemTris-based buffersTypically with added glycerol for stability

For accurate activity assessment, it's critical to ensure the peptide substrate contains the conserved cysteine residue in the lipobox. Control assays using mutant peptides where the cysteine is replaced with alanine (e.g., Pal-IAA) should show no activity .

How can researchers differentiate between different lipoprotein forms during experimental analysis?

Differentiating between various lipoprotein forms requires specialized analytical techniques:

  • SDS fractionation: This technique separates SDS-insoluble peptidoglycan-associated proteins (PAP) from SDS-soluble non-peptidoglycan-associated proteins (non-PAP). This is particularly useful for analyzing Lpp, as different forms localize to different fractions:

    • Triacylated mature Lpp is enriched in the non-PAP fraction

    • Peptidoglycan-linked Lpp forms are enriched in the PAP fraction

    • Diacylglyceryl modified pro-Lpp linked to peptidoglycan (DGPLP) can also be detected

  • Western blot analysis: Using antibodies specific to lipoproteins (such as Lpp) enables visualization of different processing intermediates. The addition of lysozyme allows identification of peptidoglycan-linked Lpp forms .

  • Mobility shift analysis: Different lipoprotein forms show distinct migration patterns on SDS-PAGE:

    • Unmodified prolipoprotein (fastest migration)

    • Diacylglyceryl-modified prolipoprotein

    • Signal peptide-cleaved, diacylglyceryl-modified lipoprotein

    • Triacylated mature lipoprotein

    • Various peptidoglycan-linked forms (slowest migration)

  • Membrane fractionation: Separation of inner and outer membranes helps localize different lipoprotein intermediates, as blocks in processing can lead to accumulation of specific forms in different membrane compartments .

What are the most common technical challenges when working with recombinant Lgt?

Researchers working with recombinant Lgt encounter several technical challenges:

  • Protein solubility and stability: As a membrane protein, Lgt requires detergents or lipid environments to maintain its native conformation and activity. Identifying optimal detergent conditions is often challenging.

  • Expression levels: Overexpression of membrane proteins can be toxic to host cells, requiring careful optimization of expression conditions.

  • Activity preservation: Maintaining enzymatic activity during purification and storage is critical. The use of 50% glycerol in storage buffers helps preserve activity, but repeated freeze-thaw cycles should be avoided .

  • Assay interference: Components in crude preparations can interfere with activity assays, necessitating careful control experiments.

  • Structural analysis challenges: Obtaining high-resolution structural data for membrane proteins like Lgt is inherently difficult, requiring specialized crystallization approaches with lipids or detergents.

  • Species-specific differences: While the core function of Lgt is conserved, there are subtle differences between species that can affect substrate specificity, inhibitor sensitivity, and optimal reaction conditions.

What are the emerging applications of Lgt in vaccine development?

Bacterial lipoproteins and their biosynthetic pathways have significant implications for vaccine development:

  • Lipoprotein-based vaccines: Bacterial lipoproteins can be potent antigens and have been included in vaccine formulations. The lipid modifications introduced by Lgt and subsequent enzymes enhance immunogenicity by engaging pattern recognition receptors .

  • Adjuvant properties: Lipoproteins serve as natural adjuvants through their interaction with Toll-like receptors (particularly TLR2), enhancing immune responses to co-administered antigens.

  • Recombinant antigen display: The lipoprotein processing pathway can be exploited to create recombinant antigens with enhanced immunogenicity by incorporating the lipobox sequence and ensuring proper processing by Lgt.

  • Attenuated vaccine strains: Conditional depletion of Lgt could potentially be used to create attenuated bacterial strains for live vaccine applications, as Lgt depletion increases bacterial susceptibility to host immune defenses .

  • Lgt inhibitor combination therapy: Emerging Lgt inhibitors could potentially be combined with vaccines to enhance efficacy through synergistic weakening of pathogen membrane integrity.

Understanding the structural basis and functional implications of Lgt-mediated modifications will continue to inform rational vaccine design strategies targeting Gram-negative pathogens.

How might the structure-guided design of Lgt inhibitors advance antimicrobial development?

The structural characterization of Lgt provides a foundation for rational inhibitor design with several promising avenues:

  • Active site targeting: Crystal structures of Lgt reveal a distinct active site architecture with critical histidine residues (H85 and H153) that could be targeted by small molecule inhibitors .

  • Substrate mimetics: Compounds that mimic either the phosphatidylglycerol donor or the lipobox-containing peptide acceptor could serve as competitive inhibitors.

  • Allosteric inhibition: Binding sites distant from the active site could be targeted to induce conformational changes that impair catalytic function.

  • Species selectivity: While the core function of Lgt is conserved, structural differences between bacterial species could be exploited to develop selective inhibitors targeting specific pathogens.

  • Resistance analysis: The apparent difficulty in developing resistance to Lgt inhibitors suggests they may have significant advantages over other antibiotic classes .

The discovery that deletion of lpp (encoding the major outer membrane lipoprotein) is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors is particularly significant. This suggests that Lgt inhibitors may overcome one of the most common resistance mechanisms that invalidate inhibitors targeting downstream steps of bacterial lipoprotein biosynthesis and transport .

How does Lgt function differ between Gram-positive and Gram-negative bacteria?

Lipoprotein processing pathways show important differences between bacterial types:

  • Processing enzymes: While Lgt function is conserved across bacterial species, the complete processing pathway differs. Gram-negative bacteria typically employ a three-enzyme pathway (Lgt, LspA, and Lnt), whereas many Gram-positive bacteria lack Lnt and have developed alternative processing mechanisms .

  • Lipoprotein intramolecular transacylase (Lit): In low-GC Gram-positive bacteria, an enzyme called Lit performs an intramolecular transacylation reaction, transferring the sn-2 acyl chain from the diacylglyceryl moiety to the α-amino group of the N-terminal cysteine, resulting in a lyso-form lipoprotein .

  • Mobile genetic elements: Some Gram-positive bacteria, like certain strains of Listeria monocytogenes and Enterococcus species, contain a second lit gene (lit2) on mobile genetic elements. Expression of lit2 is tightly regulated and induced by copper. It is co-transcribed with a second lgt (lgt2) .

  • Subcellular localization: In Gram-negative bacteria, mature lipoproteins are distributed between the inner and outer membranes, requiring the Lol transport system. In Gram-positive bacteria, which lack an outer membrane, lipoproteins remain anchored in the cytoplasmic membrane or are associated with the cell wall .

Understanding these differences is crucial for developing targeted antimicrobial strategies and for properly interpreting experimental results when working with different bacterial systems.

What are the key differences in Lgt activity and inhibition across different bacterial species?

Comparative analysis reveals several notable differences in Lgt characteristics across bacterial species:

AspectE. coli (Gram-negative)B. cereus (Gram-positive)Other Species
pH optimumSlightly acidic4.4-5.4Species-dependent
Substrate preferencePhosphatidylglycerol preferredPhosphatidylglycerol preferredMay vary with membrane composition
Inhibitor sensitivitySensitive to compounds like G2823, G2824May differ in sensitivity profileRequires species-specific testing
Genetic redundancySingle lgt geneSingle lgt geneSome species contain multiple lgt copies
Resistance mechanismsDeletion of lpp insufficient for resistanceLess characterizedLikely species-dependent
EssentialityEssential for growthEssential for growthMay vary in specialized environments

These differences highlight the importance of species-specific characterization when developing Lgt-targeted therapeutics and suggest that broad-spectrum Lgt inhibitors may be challenging to develop without careful optimization .

What emerging technologies are advancing our understanding of Lgt function?

Several cutting-edge methodologies are transforming our understanding of Lgt:

  • Cryo-electron microscopy: This technique is enabling visualization of membrane proteins like Lgt in near-native environments, providing insights into structural dynamics during catalysis.

  • Molecular dynamics simulations and quantum mechanics/molecular mechanics (QM/MM): These computational approaches have been instrumental in modeling the Lgt reaction mechanism, complementing experimental structural data .

  • Native mass spectrometry: This technique allows analysis of intact membrane protein complexes, providing insights into Lgt interactions with substrates and other components of the lipoprotein biosynthetic machinery.

  • Single-molecule enzymology: Emerging techniques for studying individual enzyme molecules could reveal heterogeneity in Lgt function and conformational states.

  • Targeted protein degradation approaches: Techniques for rapid protein depletion are enabling more precise temporal control over Lgt levels, facilitating studies of acute vs. chronic effects of Lgt loss.

These technological advances are likely to continue expanding our understanding of Lgt structure, function, and potential as a therapeutic target in the coming years.

What are the implications of Lgt research for developing novel antimicrobial strategies?

Research on Lgt has several important implications for antimicrobial development:

  • Novel target validation: The essentiality of Lgt for bacterial growth and the multiple downstream effects of its inhibition validate it as a promising antibacterial target .

  • Resistance considerations: The apparent difficulty in developing resistance to Lgt inhibitors through target modification suggests they may have advantages over other antibiotic classes. Additionally, the finding that lpp deletion doesn't confer resistance represents a significant advantage over inhibitors of downstream steps in lipoprotein biosynthesis .

  • Combination therapy potential: Lgt inhibitors could potentially synergize with other antibiotics by compromising membrane integrity and increasing bacterial susceptibility.

  • Broad-spectrum activity: Lgt inhibitors have demonstrated activity against both E. coli and A. baumannii, suggesting potential broader spectrum applications .

  • Mechanistic diversity: The direct transfer mechanism of Lgt differs from many other antibiotic targets, representing a distinct vulnerability in bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.