Recombinant Escherichia coli O9:H4 Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli O9:H4 Protein CrcB Homolog (CrcB)

The CrcB protein, a membrane protein belonging to a large superfamily of transporters, is associated with fluoride riboswitches and plays a role in fluoride resistance in various bacteria and archaea . Escherichia coli utilizes the crcB gene to encode a protein that helps in reducing the toxicity of fluoride .

Genetic Context and Function of CrcB

CrcB genes are often found in conjunction with fluoride riboswitches, which are RNA structures that regulate gene expression in response to fluoride levels . These riboswitches increase the expression of genes, like crcB, that help the organism to tolerate high levels of fluoride . The crcB gene product is believed to function as a fluoride transporter, reducing intracellular fluoride concentrations .

Role in Fluoride Resistance

  • Fluoride Sensitivity: E. coli strains with a knockout of the crcB gene are highly sensitive to fluoride, exhibiting inhibited growth even at micromolar concentrations .

  • Complementation: Ectopic expression of crcB from other species can restore fluoride resistance in E. coli strains lacking their native crcB gene, highlighting the conserved function of CrcB proteins across different bacterial species .

  • Fluoride Transport: CrcB proteins are speculated to reduce fluoride concentrations within cells, thereby reducing its toxicity .

CrcB as a Fluoride Transporter

CrcB proteins are believed to function as fluoride transporters, helping to reduce the concentration of fluoride inside the cell . Studies indicate that CrcB and EriC$$^F$$ proteins, which are fluoride-specific chloride channels, have similar roles in mitigating fluoride toxicity .

Distribution and Occurrence

CrcB genes are broadly distributed among bacteria and archaea, suggesting that many organisms face fluoride toxicity . They can be found in various microorganisms, including Streptococcus mutans, a causative agent of dental caries, emphasizing the importance of fluoride resistance in different environments .

CrcB and Chromosome Condensation

Overexpression of crcB in E. coli has been shown to protect the chromosome from decondensation induced by camphor, indicating a potential role in maintaining chromosome structure .

Regulation by Fluoride Riboswitches

Fluoride riboswitches regulate the expression of CrcB proteins by undergoing structural changes upon binding fluoride ions, which affects the transcription of downstream genes .

Functional Equivalence with EriC$$^F$$

The CrcB protein shares functional similarities with EriC$$^F$$ proteins, which are also involved in fluoride transport . The co-occurrence of either crcB or eriC$$^F$$ genes in different bacterial species suggests that these proteins have equivalent biochemical roles in fluoride resistance .

Stress Response

P. putida responds to sodium fluoride (NaF) exposure with a complex, multi-level stress response, demonstrating the importance of proteins like CrcB in managing fluoride-related stress .

Table: Comparison of Wild-Type and crcB Knockout E. coli Strains under Fluoride Stress

FeatureWild-Type E. colicrcB Knockout E. coli
Growth in High FluorideNoticeably reducedInhibited
Minimum Inhibitory Concentration (MIC) of Fluoride~200 mMSlightly >1 mM
Reporter Gene ExpressionProportional to FF- until toxicShifted to lower FF-

Table: Overview of CrcB Function and Characteristics

CharacteristicDescription
Protein TypeMembrane protein, part of a superfamily of transporters
FunctionReduces intracellular fluoride concentrations, thus reducing its toxicity
RegulationRegulated by fluoride riboswitches
RoleConfers resistance to fluoride
DistributionBroadly distributed among bacteria and archaea
Functional EquivalenceShares functional similarity with EriC$$^F$$ proteins
Additional RoleProtects chromosome from decondensation by camphor when overexpressed

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag type is required, please inform us, and we will prioritize its development.
Synonyms
crcB; EcHS_A0676; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function

Important Function: Reduces intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the CrcB homolog protein in Escherichia coli O9:H4?

The CrcB homolog protein in Escherichia coli O9:H4 (strain HS) is a membrane protein encoded by the crcB gene (locus name: EcHS_A0676). It belongs to a family of proteins found across various bacterial species with a primary role in membrane function. The protein consists of 127 amino acids with the sequence beginning with mLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANL and continuing through to FSASTAH . Current research suggests CrcB homologs are involved in regulatory functions related to DNA topology modulation .

How does CrcB homolog differ from other membrane proteins in E. coli?

Unlike mechanosensitive channels such as YbdG that directly respond to membrane tension during osmotic stress conditions, the CrcB homolog appears to function primarily through modulation of DNA topology rather than direct binding to promoter regions . While proteins like YbdG extend the range of hypoosmotic shock survival in E. coli through channel activity, CrcB exhibits a distinct regulatory mechanism that affects gene expression patterns. The transmembrane structure of CrcB homolog features characteristic hydrophobic domains that facilitate its integration into the bacterial membrane, distinguishing it from water-soluble regulatory proteins.

What is the genomic context of the crcB gene in E. coli strains?

The crcB gene (EcHS_A0676 in strain HS) exists within the broader genomic landscape of E. coli, which typically contains a circular chromosome of approximately 5.14 million base pairs encoding nearly 4,805 proteins . In the original E. coli strain (NCTC 86), large genomic rearrangements have been observed, including a 2.8 million bp inversion spanning the replication terminus region . While the specific positioning of crcB relative to these arrangements isn't directly addressed in the available data, understanding such genomic context is crucial for researchers investigating regulatory networks and functional relationships between genes.

How does CrcB homolog function in cellular stress response mechanisms?

The function of CrcB homolog in stress response appears to differ significantly from other stress-response proteins like YbdG. While mechanosensitive channels like YbdG provide direct protection against hypoosmotic shock through channel activity that relieves membrane tension , CrcB's role appears to be regulatory, affecting DNA topology when overexpressed . This suggests CrcB may participate in transcriptional regulation of stress response genes rather than providing immediate physical protection to the cell membrane. Researchers investigating CrcB should consider designing experiments that monitor changes in gene expression patterns under different stress conditions when CrcB is expressed at various levels.

What structural features contribute to CrcB homolog function?

The amino acid sequence of CrcB homolog (mLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH) reveals several hydrophobic regions characteristic of membrane proteins. Analysis of this sequence suggests multiple transmembrane domains that likely anchor the protein within the bacterial membrane. The specific arrangement of these domains creates a three-dimensional structure that facilitates interaction with DNA and/or other regulatory proteins. Researchers should consider employing techniques such as site-directed mutagenesis of conserved residues to determine which amino acids are crucial for function.

How does CrcB homolog expression change under varying environmental conditions?

Based on patterns observed with other E. coli regulatory proteins, CrcB homolog expression likely responds to specific environmental triggers. Unlike proteins such as MscS, MscL, and YbiO that show RpoS-dependent expression, some regulatory factors exhibit inhibition by RpoS . This differential regulation suggests complex control mechanisms that researchers should investigate through comprehensive expression studies. Potential experimental approaches include qPCR analysis of crcB transcription under various stress conditions (osmotic stress, pH changes, nutrient limitation) and Western blot analysis to correlate transcript levels with protein abundance.

What are the optimal conditions for expressing recombinant CrcB homolog protein?

For optimal expression of recombinant CrcB homolog from E. coli O9:H4, researchers should consider the following protocol:

  • Expression System Selection: Given the membrane-associated nature of CrcB, an E. coli-based expression system with a strong inducible promoter (such as T7 or araBAD) is recommended.

  • Growth Conditions: Initial cultivation should be performed at 37°C until OD600 reaches 0.6-0.8, followed by temperature reduction to 18-25°C prior to induction to enhance proper folding of membrane proteins.

  • Induction Parameters: Use lower inducer concentrations (0.1-0.5 mM IPTG for T7 systems) and extend expression time (16-24 hours) to maximize yield of properly folded protein.

  • Harvest and Storage: Cell pellets should be collected by centrifugation at 4,000-6,000 × g for 15 minutes at 4°C and can be stored at -80°C until extraction.

Successfully expressed protein should be verified by SDS-PAGE and Western blot analysis using antibodies specific to CrcB homolog or to an incorporated affinity tag.

What purification strategies are most effective for isolating CrcB homolog with high purity?

The purification of membrane proteins like CrcB homolog requires specialized techniques:

Table 1: Purification Strategy Comparison for CrcB Homolog

Purification StepMethodBuffer CompositionExpected YieldPurity Level
Membrane ExtractionUltracentrifugation50 mM Tris-HCl pH 8.0, 150 mM NaCl100% (relative)Low
SolubilizationDetergent TreatmentAbove buffer + 1% DDM or LDAO70-85%Medium
Affinity ChromatographyNi-NTA or TALONAbove buffer + 0.1% detergent, 10-300 mM imidazole50-70%High
Size ExclusionSuperdex 20050 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% detergent30-50%Very High

Following purification, the protein should be stored in Tris-based buffer with 50% glycerol at -20°C, avoiding repeated freeze-thaw cycles to maintain activity. Working aliquots can be maintained at 4°C for up to one week .

How can researchers effectively design functional assays for CrcB homolog?

When designing functional assays for CrcB homolog, researchers should consider its potential regulatory role in DNA topology :

  • DNA Supercoiling Assays: Given CrcB's reported effect on DNA topology, assays measuring changes in DNA supercoiling (such as chloroquine gel electrophoresis) in the presence and absence of CrcB would be informative.

  • Fluorescence-Based Membrane Localization: Tagging CrcB with fluorescent proteins can help visualize its cellular localization and potential redistribution under various stress conditions.

  • Protein-DNA Interaction Studies: While direct binding to promoter regions isn't indicated , chromatin immunoprecipitation (ChIP) assays could identify regions of DNA that associate with CrcB-containing complexes.

  • Growth Phenotype Analysis: Similar to studies with YbdG , comparing growth and survival of wild-type, crcB deletion, and crcB overexpression strains under various stress conditions (particularly osmotic stress) can provide insights into functional roles.

  • Transcriptome Analysis: RNA-seq comparing gene expression patterns between wild-type and crcB mutant strains can identify regulatory networks influenced by CrcB activity.

What are the common difficulties in studying membrane proteins like CrcB and how can they be addressed?

Membrane proteins like CrcB present several research challenges:

  • Expression Difficulties: Membrane proteins often exhibit toxicity when overexpressed. To address this, researchers should use tightly regulated expression systems and consider reduced expression temperatures.

  • Solubility Issues: Maintaining proper folding and solubility requires optimization of detergent types and concentrations. Screening multiple detergents (DDM, LDAO, LMNG) is recommended for identifying optimal solubilization conditions.

  • Functional Assay Development: Unlike enzymes with easily measurable catalytic activities, regulatory proteins like CrcB require indirect measurements of function. Researchers should combine multiple approaches, including genetic (complementation studies), biochemical (DNA topology assays), and physiological (stress response) analyses.

  • Structural Determination: Obtaining high-resolution structural data for membrane proteins remains challenging. Approaches combining cryoEM, crystallography attempts, and computational modeling can provide complementary structural insights.

How can genomic analysis inform functional studies of CrcB homolog?

Genomic approaches provide valuable context for understanding CrcB function:

  • Comparative Genomics: Analyzing the conservation and synteny of crcB across E. coli strains and related species can identify functional associations. For example, comparing the crcB context in the 5.14 Mb chromosome of the original E. coli strain with other sequenced strains might reveal consistent gene neighborhoods.

  • Transcriptomic Correlation: RNA-seq data from various growth conditions can identify genes with expression patterns that correlate with crcB, suggesting functional relationships or shared regulatory mechanisms.

  • Mutation Analysis: Natural variations in crcB sequences across E. coli strains may correlate with phenotypic differences, particularly in stress response capabilities.

  • Promoter Analysis: Examining the crcB promoter region for binding sites of known transcription factors can help integrate CrcB into established regulatory networks.

What emerging technologies are advancing research on bacterial membrane proteins like CrcB?

Several cutting-edge technologies are enhancing membrane protein research:

  • Cryo-Electron Microscopy: Recent advances in cryoEM have revolutionized membrane protein structural biology, allowing researchers to obtain high-resolution structures without crystallization.

  • Native Mass Spectrometry: This technique enables analysis of membrane proteins in near-native states, providing insights into oligomerization states and protein-protein interactions.

  • Single-Molecule Tracking: Advanced microscopy techniques allow tracking of individual fluorescently labeled CrcB molecules in living cells, revealing dynamic behaviors and spatial organization.

  • Nanodiscs and SMALPs: These technologies provide alternative membrane mimetics that better preserve protein structure and function compared to traditional detergent solubilization.

  • AlphaFold and Related AI Tools: Computational prediction of protein structures has advanced significantly, offering preliminary structural models that can guide experimental design even without crystallographic data.

What are the most promising research directions for understanding CrcB homolog function?

Future research on CrcB homolog should focus on:

  • Structural Characterization: Determining high-resolution structures using cryoEM or X-ray crystallography to understand the molecular basis of CrcB function.

  • Interaction Networks: Identifying protein and DNA interaction partners using techniques like BioID, pull-down assays coupled with mass spectrometry, and DNA-protein interaction studies.

  • Physiological Role Clarification: Developing comprehensive phenotypic profiles of crcB deletion and overexpression strains under various stress conditions, particularly focusing on conditions where DNA topology changes are known to be important.

  • Evolutionary Analysis: Examining the conservation and divergence of CrcB function across bacterial species to understand its fundamental importance in bacterial physiology.

  • Integration with Systems Biology: Positioning CrcB within the broader regulatory networks of E. coli through multi-omics approaches that combine transcriptomics, proteomics, and metabolomics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.