Recombinant Escherichia coli O9:H4 Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Enzymatic Mechanism and Substrate Specificity

GlpG cleaves transmembrane substrates through a two-step process:

  1. Substrate Recognition: Targets helix-destabilizing residues (e.g., prolines) in transmembrane domains (TMDs) of orphaned proteins .

  2. Catalysis: Utilizes a Ser-His catalytic dyad for hydrolysis, with non-competitive inhibition observed using peptide aldehydes (e.g., Ac-RKVRMA-CHO, K<sub>i</sub> = 113 μM) .

Key Findings:

  • Cleavage occurs between Ser and Asp residues in hydrophilic regions near the membrane-periplasm interface .

  • Substrates include components of respiratory complexes (e.g., hydrogenase-2, formate dehydrogenases) when unassembled .

Gut Colonization

GlpG enhances E. coli persistence in the mammalian gut by promoting fatty acid β-oxidation and glycerol metabolism. Disruption of glpG reduces bacterial fitness >120-fold in murine models .

Quality Control

GlpG mediates proteolytic quality control by degrading orphan subunits of respiratory complexes (e.g., HybA, FdnH) that fail to assemble, preventing cytotoxic accumulation .

Recombinant Production and Applications

Recombinant GlpG is commercially available for research, with specifications including:

ParameterDetails
Storage Conditions-20°C in Tris buffer with 50% glycerol
Purity>90% (SDS-PAGE verified)
ApplicationsEnzyme kinetics, structural studies, inhibitor screening

Key Research Advances

  • Structural Insights: Active-site gating mechanisms and transition-state stabilization were elucidated using Y205F GlpG mutants crystallized in membrane bicelles .

  • Inhibition Studies: Peptide aldehydes mimic substrate transition states, revealing non-competitive inhibition kinetics (K<sub>i</sub> = 113–250 μM) .

  • Biological Relevance: GlpG supports E. coli survival under low-oxygen conditions by regulating respiratory complex turnover .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
glpG; EcHS_A3621; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of E. coli Rhomboid protease GlpG?

GlpG is a prototype of the serine intramembrane protease family, characterized by its membrane-embedded nature. Crystallography studies have revealed its structure at 2.3 Å resolution when complexed with diisopropyl fluorophosphonate. The protein traverses the membrane six times, creating a unique structural arrangement that facilitates its proteolytic function. The conserved Ser and His residues are essential for its proteolytic activities, resembling the catalytic dyad found in classical serine proteases .

How does the topology of GlpG relate to its function?

GlpG has a verified topology traversing the membrane six times. This arrangement is critical for its function as an intramembrane protease, as it positions the catalytic residues within the membrane environment where they can access substrate transmembrane domains. The membrane-spanning regions create a hydrophilic pocket that likely accommodates the scissile bond of substrates, allowing for proteolysis to occur in an otherwise hydrophobic environment. This topology is conserved among rhomboid proteases and represents a fundamental structural feature that enables their specialized proteolytic mechanism .

What are the key catalytic residues in E. coli GlpG and how do they function?

The catalytic mechanism of GlpG depends primarily on conserved Serine and Histidine residues. These residues form a catalytic dyad that is essential for the proteolytic activity. During substrate cleavage, the Serine residue acts as a nucleophile that attacks the carbonyl carbon of the scissile peptide bond, forming a tetrahedral intermediate. The Histidine facilitates this process by acting as a general base, abstracting a proton from the serine residue to enhance its nucleophilicity. Crystallographic studies with inhibitors like diisopropyl fluorophosphonate have provided models for understanding this tetrahedral transitional state during catalysis .

How does the antigenic cross-reactivity between E. coli O9 and O104 impact research on GlpG expression systems?

The documented antigenic cross-reaction between E. coli O9 and O104 presents significant implications for research on GlpG expression systems. Absorption tests have shown that anti-E. coli O9 serum exhibits reactivity against both O9 and O104 antigens at dilutions of 1:1600 and 1:400 respectively, while anti-E. coli O104 serum shows responses at dilutions of 1:200 against O9 and 1:1600 against O104 antigens. This cross-reactivity must be carefully considered when designing immunological detection methods for recombinant GlpG expressions in E. coli O9:H4 systems, as it may lead to false positive results in serological assays .

When developing purification protocols for recombinant GlpG, researchers should implement additional verification steps beyond serological identification to confirm the precise strain lineage and avoid mischaracterization due to shared antigenic determinants. Practical approaches include using absorbed antisera specific to each serogroup and complementing serological tests with molecular characterization methods based on strain-specific genomic markers.

What experimental approaches are most effective for analyzing GlpG substrate specificity in E. coli O9:H4?

The analysis of GlpG substrate specificity requires a multi-faceted experimental approach. Based on established protocols, the most effective strategy combines:

  • In vivo model substrate systems: Utilizing fusion proteins containing N-terminal periplasmically localized domains (such as beta-lactamase), specific transmembrane regions, and cytosolic reporter domains (such as maltose binding protein) to monitor GlpG-dependent cleavage in cellular contexts.

  • In vitro reconstitution assays: Purifying both GlpG and candidate substrate proteins to demonstrate direct proteolytic activity under controlled conditions, which eliminates confounding factors present in cellular environments.

  • Cleavage site mapping: Identifying that cleavage typically occurs between specific amino acid pairs (like Ser and Asp) in regions of high local hydrophilicity, which may be positioned in juxtamembrane rather than intramembrane locations.

  • Transmembrane domain analysis: Systematically varying the features of transmembrane regions in model substrates to identify specific recognition elements that determine GlpG specificity .

How do mutations in conserved catalytic residues of GlpG affect its proteolytic mechanism and substrate recognition?

Mutations in the conserved Serine and Histidine residues of GlpG completely abolish its proteolytic activity, confirming their essential role in catalysis. Beyond these primary catalytic residues, several other conserved amino acids contribute to substrate recognition and processing:

Residue TypePositionEffect of MutationMechanistic Impact
SerineCatalytic siteComplete loss of activityEliminates nucleophilic attack
HistidineCatalytic siteComplete loss of activityPrevents activation of serine
Residues in L1 loopVariableReduced substrate accessAlters gating mechanism
Transmembrane recognition motifsTM domainsAltered substrate specificityChanges binding affinity

What purification protocols yield the highest activity for recombinant E. coli O9:H4 GlpG?

Purification of recombinant GlpG from E. coli O9:H4 requires specialized approaches to maintain the integrity and activity of this membrane protein. The following protocol has been demonstrated to yield highly active preparations:

  • Membrane fraction isolation: Cells expressing GlpG should be disrupted by sonication or French press, followed by differential centrifugation to isolate membrane fractions (typically 100,000×g pellet).

  • Detergent solubilization: The membrane fraction should be solubilized using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-decyl-β-D-maltoside (DM) at concentrations slightly above their critical micelle concentration.

  • Affinity chromatography: Using a C-terminal His-tag or other affinity tag, the solubilized protein can be purified via immobilized metal affinity chromatography.

  • Size exclusion chromatography: A final polishing step using size exclusion chromatography in the presence of detergent is crucial for obtaining homogeneous and active enzyme preparations.

For optimal activity retention, all purification steps should be performed at 4°C, and the final buffer should contain 0.03-0.05% DDM, 50 mM Tris-HCl (pH 8.0), 150 mM NaCl, and 10% glycerol to stabilize the protein structure and prevent aggregation .

How can researchers effectively analyze the integration of GlpG into bacterial membranes?

Analysis of GlpG membrane integration requires multiple complementary approaches:

  • Topology mapping: Combining reporter fusion proteins (e.g., PhoA or GFP) at various positions to determine membrane orientation, complemented by protease accessibility assays to identify exposed regions.

  • Membrane fractionation: Sucrose gradient ultracentrifugation to separate inner and outer membranes, confirming GlpG localization to the inner membrane fraction.

  • Fluorescence microscopy: Using fluorescently tagged GlpG to visualize membrane distribution in live cells, potentially revealing localization patterns within the membrane.

  • Crosslinking studies: Chemical crosslinking followed by mass spectrometry to identify neighboring proteins and lipids that may influence GlpG folding and activity.

  • Atomic force microscopy: Direct visualization of GlpG within membrane environments to assess organization and potential oligomeric states.

Each of these methods provides distinct and complementary information about GlpG's membrane integration, and combining multiple approaches offers the most comprehensive understanding of its native membrane environment .

What are the optimal conditions for measuring GlpG proteolytic activity in vitro?

The in vitro measurement of GlpG proteolytic activity requires carefully optimized conditions:

ParameterOptimal ConditionRationale
pH7.4-8.0Maintains optimal catalytic dyad protonation state
Temperature30-37°CBalances enzyme activity with stability
Detergent0.03-0.05% DDM or DMMaintains native-like membrane environment
Substrate concentration1-10 μMBelow saturation to maintain linear kinetics
Reaction time1-4 hoursAllows sufficient product formation for detection
Buffer components50 mM Tris-HCl, 150 mM NaClProvides physiological ionic strength

Activity can be monitored using fluorogenic peptide substrates or by tracking the cleavage of model protein substrates via SDS-PAGE and Western blotting. For quantitative kinetic analysis, initial reaction rates should be determined under conditions where substrate conversion is limited to <20% to ensure steady-state assumptions are valid. The cleavage occurs predominantly between Ser and Asp residues in regions of high local hydrophilicity, and assay design should account for this specificity .

How should researchers design experiments to investigate potential physiological substrates of GlpG in E. coli O9:H4?

Investigating physiological substrates of GlpG requires a systematic approach combining genomic, proteomic, and functional analyses:

  • Comparative proteomics: Analyze membrane proteome differences between wild-type and ΔglpG E. coli O9:H4 strains using stable isotope labeling with amino acids in cell culture (SILAC) followed by mass spectrometry to identify proteins with altered processing or abundance.

  • In vivo substrate trapping: Generate catalytically inactive GlpG mutants (e.g., S201A) that can bind but not cleave substrates, then use crosslinking and co-immunoprecipitation to identify trapped candidate substrates.

  • Bioinformatic prediction: Screen the E. coli O9:H4 proteome for transmembrane proteins with sequence features similar to known GlpG substrates, focusing on proteins with transmembrane domains exhibiting the characteristic hydrophobicity profiles recognized by GlpG.

  • Genetic interaction mapping: Perform synthetic genetic array analysis with ΔglpG to identify genes showing genetic interactions, potentially indicating functional relationships with GlpG substrates or pathways.

  • Direct validation: For each candidate substrate identified through these approaches, confirm direct cleavage by GlpG both in vivo and in vitro, mapping precise cleavage sites and demonstrating the functional consequences of processing .

What controls are essential when examining the role of GlpG in E. coli O9:H4 pathogenicity?

When investigating GlpG's role in E. coli O9:H4 pathogenicity, the following controls are essential:

  • Complementation controls: The ΔglpG strain should be complemented with both wild-type glpG and catalytically inactive mutants (S201A, H254A) to distinguish between proteolytic and potential non-proteolytic functions.

  • Strain background verification: Given the antigenic cross-reactivity between O9 and O104 serogroups, rigorous verification of strain background using absorbed antisera and molecular typing is critical to prevent misinterpretation due to strain misidentification.

  • Virulence factor expression control: Monitor expression levels of known virulence factors in wild-type and ΔglpG strains to identify any indirect effects on pathogenicity due to altered gene expression rather than direct GlpG activity.

  • Growth rate normalization: Adjust all pathogenicity assays for potential growth differences between wild-type and mutant strains to avoid confounding effects due to growth defects rather than virulence.

  • Host cell controls: When using cell culture infection models, include controls for host cell viability and non-specific effects of bacterial components to ensure observed phenotypes are specifically attributable to GlpG function .

Why might recombinantly expressed GlpG show reduced or absent proteolytic activity?

Several factors can contribute to reduced activity in recombinant GlpG preparations:

  • Improper membrane integration: GlpG requires proper six-transmembrane topology for activity. Expression conditions that lead to misfolding or improper membrane integration will yield inactive protein.

  • Detergent-mediated inactivation: Harsh detergents can denature GlpG or distort its active site. Always use mild detergents like DDM or DM at minimal effective concentrations.

  • Loss of essential lipids: GlpG activity may depend on specific lipid interactions. Purification protocols that strip away all native lipids might reduce activity, which can be restored by adding back E. coli total lipid extract.

  • Oxidation of catalytic residues: The catalytic serine and histidine are susceptible to oxidation. Include reducing agents like DTT (1-5 mM) in purification and assay buffers.

  • Suboptimal substrate design: If using model substrates, ensure they contain appropriate transmembrane domains with features recognized by GlpG. The cleavage site should be in a region of local hydrophilicity, typically between specific residues like Ser and Asp.

  • Expression host effects: Expression in heterologous hosts may lead to protein modifications not present in native E. coli O9:H4, potentially affecting activity .

How can researchers address cross-reactivity issues when working with E. coli O9:H4 in serological studies?

Addressing cross-reactivity between E. coli O9 and O104 in serological studies requires several targeted approaches:

  • Serum absorption: Pre-absorb antisera with heterologous antigens to remove cross-reactive antibodies. For example, anti-O9 serum should be absorbed with O104 antigens and vice versa before use in specific detection.

  • Multiple verification methods: Never rely solely on serological identification. Always confirm strain identity using PCR-based methods targeting serogroup-specific genes.

  • Epitope mapping: Identify the specific cross-reactive epitopes between O9 and O104 to design more specific detection antibodies that target unique regions.

  • Dilution optimization: Determine the optimal antibody dilution where cross-reactivity is minimized while specific detection is maintained. For anti-O9 serum, dilutions of 1:1600 show strong specific reaction while reducing cross-reactivity.

  • Alternative detection methods: When possible, use non-serological methods like mass spectrometry or genetic sequencing to confirm strain identity.

These approaches can significantly reduce misidentification issues arising from the documented antigenic cross-reactivity between these E. coli serogroups .

How should researchers interpret differences in GlpG activity between clinical and laboratory E. coli O9:H4 isolates?

When analyzing variations in GlpG activity between clinical and laboratory E. coli O9:H4 isolates, researchers should consider multiple factors:

  • Genetic variation analysis: Sequence the glpG gene and its regulatory regions from multiple isolates to identify natural polymorphisms that may affect expression or function. Compare these to reference sequences to identify potential adaptive mutations.

  • Expression level assessment: Quantify GlpG protein levels using Western blotting with specific antibodies to determine if activity differences stem from expression variation rather than intrinsic protein differences.

  • Environmental adaptation context: Consider the selective pressures in clinical versus laboratory environments. Clinical isolates may have adapted to host defense mechanisms, antimicrobial exposure, or specific nutrient limitations that affect GlpG function.

  • Substrate availability differences: Examine the presence and abundance of potential GlpG substrates in different isolates, as co-evolution of enzyme and substrates may drive activity variations.

  • Statistical robustness: Ensure sufficient biological and technical replicates (minimum n=3 for each), and apply appropriate statistical tests to determine if observed differences are significant.

What statistical approaches are most appropriate for analyzing GlpG kinetic data?

The analysis of GlpG kinetic data requires specialized statistical approaches appropriate for membrane enzyme systems:

  • Non-linear regression for Michaelis-Menten parameters: Use non-linear regression rather than linear transformations (e.g., Lineweaver-Burk) to determine Km and Vmax values, as linear transformations can distort error distribution.

  • Global fitting for inhibition studies: When analyzing competitive, non-competitive, or mixed inhibition patterns, apply global fitting approaches that simultaneously consider all inhibitor concentrations.

  • Bootstrap resampling: Use bootstrap methods to establish confidence intervals for kinetic parameters, particularly when working with limited data points due to substrate availability constraints.

  • Outlier analysis: Apply robust regression techniques that are less sensitive to outliers, particularly important for membrane enzyme systems where detergent effects can introduce variability.

  • Model comparison using Akaike Information Criterion (AIC): When multiple kinetic models could explain the data, use AIC to objectively select the most appropriate model without overfitting.

For time-course experiments, consider progress curve analysis that accounts for substrate depletion and product inhibition effects, which are common in GlpG reactions due to the limited turnover rates typical of intramembrane proteases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.