Catalyzes the excretion of spermidine.
KEGG: ecx:EcHS_A1674
MdtJ is a 121-amino acid membrane protein that functions as part of the MdtJI complex in Escherichia coli. It belongs to the small multidrug resistance (SMR) family of drug exporters and contains four transmembrane segments with most functional amino acid residues facing the cytoplasm. The primary function of MdtJ, working in conjunction with MdtI, is to catalyze the excretion of spermidine from bacterial cells, particularly when spermidine levels become elevated . This structural organization resembles that of other polyamine excretion proteins such as PotE and CadB, suggesting evolutionary conservation of polyamine transport mechanisms .
Both MdtJ and MdtI proteins are absolutely required for functional spermidine export activity. When either mdtJ or mdtI was individually transformed into spermidine acetyltransferase-deficient E. coli strains (CAG2242), cell viability did not increase significantly in spermidine-rich environments. Only when both proteins were expressed together was there substantial recovery of cell viability, increasing more than 1,000-fold compared to control cells . This complementary relationship indicates that MdtJ and MdtI likely form a heterodimeric or multimeric complex in the cell membrane to create a functional spermidine export channel. The proteins are coexpressed from the mdtJI operon, further supporting their functional interdependence .
Under normal physiological conditions, the mdtJI operon is expressed at very low levels. This tight regulation is primarily mediated by H-NS (histone-like nucleoid structuring protein), a major nucleoid protein that acts as a repressor by directly binding to the regulatory region of the mdtJI operon . Gel-retardation experiments have confirmed this direct interaction between H-NS and the mdtJI promoter region. The H-NS protein typically binds to AT-rich, curved DNA sequences and forms nucleoprotein complexes that prevent RNA polymerase from accessing the promoter, thereby inhibiting transcription initiation . This repression mechanism ensures that the spermidine export system is not unnecessarily active when polyamine levels are within normal ranges.
Spermidine levels significantly influence the expression of the MdtJI complex through a feedback regulatory mechanism. Research has demonstrated that the level of mdtJI mRNA increases in response to elevated spermidine concentrations, suggesting that spermidine either directly or indirectly activates transcription of the mdtJI operon . This response is particularly pronounced in Shigella, where naturally high spermidine levels contribute to increased expression of mdtJI compared to E. coli . The upregulation in response to spermidine creates a homeostatic mechanism whereby the cell increases its spermidine export capacity precisely when needed to prevent toxic accumulation. This regulation allows bacteria to maintain optimal spermidine levels for cellular functions while avoiding the detrimental effects of polyamine excess.
MdtJ consists of 121 amino acids with the complete sequence being: MYIYWILLGLAIATEGTLSMKWASVSEGGFILMLVMISLSYIFLSFAVKKIALGVAYALWEGIGIFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGAV . The protein contains four transmembrane segments with most functional residues facing the cytoplasm. Critical amino acid residues for spermidine export activity include Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 . These residues likely form part of the binding site for spermidine or are involved in the conformational changes necessary for the transport process. The structural organization of MdtJ with four transmembrane domains is characteristic of the SMR family of transporters and facilitates the movement of polyamines across the cell membrane.
Detailed molecular studies have identified six specific amino acid residues in MdtJ that are crucial for its spermidine export activity: Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 . Similarly, in MdtI, the residues Glu5, Glu19, Asp60, Trp68, and Trp81 are involved in the excretion activity. These findings suggest that these residues likely participate in spermidine binding or in the conformational changes necessary for the transport process. The presence of acidic residues (Glu) among the critical amino acids suggests their importance in interacting with the positively charged polyamine substrate. Meanwhile, the aromatic residues (Tyr, Trp) may participate in cation-π interactions with the polyamine. These structure-function relationships provide valuable insights for researchers investigating the molecular mechanism of polyamine transport.
Naturally high spermidine levels typically found in Shigella stimulate mdtJI expression
The presence of VirF, a plasmid-encoded regulator of the Shigella virulence regulatory cascade, enhances mdtJI expression
Bile components present in the intestinal environment further stimulate mdtJI expression in Shigella
These differences in mdtJI regulation may contribute to the pathogenic nature of Shigella, as the MdtJI complex could serve as a "safety valve" allowing Shigella to maintain optimal spermidine levels during infection while preventing toxicity due to over-accumulation .
Environmental factors, particularly bile components, significantly influence the expression of mdtJI, especially in pathogenic bacteria like Shigella. Research has demonstrated that exposure to deoxycholate (2.5-5 mg/ml) or bile salts (6-9 mg/ml) stimulates the expression of the mdtJI operon . This upregulation in response to bile is particularly relevant for enteric pathogens like Shigella, which encounter bile in the intestinal environment during infection. The exact mechanism by which bile components enhance mdtJI expression is not fully elucidated, but it may involve changes in membrane properties or activation of stress-response pathways that counteract H-NS-mediated repression. This bile-responsive regulation suggests that the MdtJI complex may play an important role during the colonization of the intestinal tract and subsequent pathogenesis, potentially contributing to the bacterium's ability to adapt to the host environment.
H-NS (histone-like nucleoid structuring protein) plays a central role in regulating the mdtJI operon by acting as a transcriptional repressor. In vivo transcription assays and gel-retardation experiments have confirmed that H-NS directly binds to the mdtJI regulatory region, forming nucleoprotein complexes that prevent RNA polymerase from accessing the promoter and inhibiting transcription initiation . This repression ensures that the mdtJI operon is expressed at very low levels under normal physiological conditions. The importance of H-NS in mdtJI regulation has been demonstrated through experiments with hns mutant strains, which show increased expression of mdtJI compared to wild-type strains . In pathogenic bacteria like Shigella, the H-NS-mediated repression can be counteracted by specific factors such as VirF and high spermidine levels, allowing for increased expression of mdtJI under conditions where spermidine export becomes necessary for cell survival or virulence .
Several methodologies have proven effective for studying MdtJ function in vivo:
Genetic complementation studies: Transformation of mdtJI-deficient or spermidine acetyltransferase-deficient strains with plasmids expressing mdtJ, mdtI, or both, followed by assessment of cell viability in spermidine-rich environments. This approach has been successfully used to demonstrate the necessity of both MdtJ and MdtI for functional spermidine export .
Polyamine content analysis: Measuring intracellular and extracellular polyamine levels using techniques such as HPLC to quantify the effect of MdtJI expression on polyamine distribution. This method has revealed that MdtJI expression significantly reduces intracellular spermidine accumulation in cells cultured with exogenous spermidine .
Radioactive transport assays: Using [14C]spermidine to pre-load cells and measure excretion rates over time. This approach provides direct evidence of MdtJI-mediated spermidine export and allows for kinetic analysis of transport activity .
Gene expression analysis: Primer extension analysis to identify promoter regions, coupled with in vivo transcription assays to evaluate expression levels under various conditions. These techniques have been used to characterize the regulation of the mdtJI operon by factors such as H-NS, spermidine, and VirF .
Site-directed mutagenesis has been instrumental in identifying critical amino acid residues involved in MdtJ function and can be applied to further study the protein through several approaches:
Targeting specific functional residues: Mutating identified critical residues (Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82) to analyze their individual contributions to spermidine binding and transport . This approach can employ alanine scanning mutagenesis, where each residue is systematically replaced with alanine to assess its importance.
Transmembrane domain analysis: Creating systematic mutations in the transmembrane segments to map the spermidine translocation pathway. This can help identify residues that line the transport channel or participate in conformational changes during the transport cycle.
Protein-protein interaction studies: Introducing mutations at putative MdtJ-MdtI interaction sites to understand complex formation and the molecular basis for the requirement of both proteins.
Regulatory region analysis: Mutating potential regulatory elements in the mdtJI promoter region to dissect transcriptional control mechanisms, including H-NS binding sites and potential VirF-responsive elements .
For these studies, researchers typically use PCR-based mutagenesis techniques with primers containing the desired mutations. The mutated genes are then cloned into expression vectors like pUC119 under the control of inducible promoters for functional analysis .
Based on published research, the following experimental conditions are optimal for measuring MdtJI-mediated spermidine export:
Buffer composition: A buffer containing 0.4% glucose, 62 mM potassium phosphate (pH 7.0), 1.7 mM sodium citrate, 7.6 mM (NH4)2SO4, and 0.41 mM MgSO4 has been successfully used for spermidine transport assays .
Cell preparation: Cells should be cultured to mid-logarithmic phase (A540 of 0.5) and harvested before transport measurements. For radioactive assays, cells at a concentration of 0.2 mg protein/ml buffer are optimal .
Spermidine preloading: For export assays, cells can be preloaded with 1 mM [14C]spermidine (37 MBq/mmol) for 90 minutes to ensure sufficient substrate for measuring export activity .
Incubation conditions: Transport assays are typically performed at 37°C for 30-60 minutes, with samples collected at regular intervals to track export kinetics .
Sample processing: After incubation, cells are removed by centrifugation at 17,000 × g, and polyamines in the supernatant are quantified either by measuring radioactivity or by HPLC analysis .
These conditions can be adjusted based on the specific aspects of MdtJI function being investigated and the experimental system being used.
For recombinant production of MdtJ, several expression systems have been successfully employed:
pUC-based vectors: The pUC119 vector under the control of the lacUV5 promoter has been effectively used for expression of mdtJ, either alone or in combination with mdtI . This system allows for high-copy expression and can be induced with IPTG.
pMW-based vectors: For lower-copy expression, which may be preferable when studying membrane proteins to avoid toxicity, pMW119 vectors have been successfully employed .
Tagged protein production: For detection and purification purposes, MdtJ has been successfully expressed with C-terminal tags such as the HA3 tag. Plasmids like YEp-HA3-3′-UTR·UGA4 have been modified to create YEp-mdtJ-HA3 for tagged protein expression .
When expressing membrane proteins like MdtJ, it's important to consider potential toxicity from overexpression. Starting with low-copy vectors or tightly regulated promoters may be advisable, with optimization of induction conditions to maximize yield while minimizing cellular stress. For functional studies, co-expression of MdtJ with MdtI is necessary, as both proteins are required for spermidine export activity .
Distinguishing MdtJI-mediated spermidine export from other polyamine transport systems requires careful experimental design:
Genetic approaches: Using deletion mutants (ΔmdtJI, ΔpotE, etc.) to isolate the contribution of specific transport systems. This approach has been used to demonstrate that among 33 putative drug transporters, only MdtJI conferred significant protection against spermidine toxicity in a spermidine acetyltransferase-deficient background .
pH-dependent activity: Unlike PotE and CadB, which function as uptake proteins at neutral pH and export proteins at acidic pH, MdtJI functions as an exporter at neutral pH. Conducting transport assays at different pH values can help distinguish between these systems .
Substrate specificity: MdtJI primarily exports spermidine but can also promote putrescine excretion . Comparing transport rates for different polyamines can help identify the specific contribution of MdtJI.
Inhibitor sensitivity: Different polyamine transporters may exhibit differential sensitivity to inhibitors. While specific inhibitors for MdtJI have not been described in the provided search results, this approach could potentially be useful.
Expression analysis: Monitoring the expression of different polyamine transport systems under various conditions can help interpret transport data, as transcriptional regulation may determine which systems are active .
The MdtJ protein, as part of the MdtJI complex, offers several applications as a tool for polyamine research:
Manipulation of intracellular polyamine levels: Overexpression of MdtJI can be used to reduce intracellular spermidine levels, allowing researchers to study the effects of polyamine depletion on various cellular processes without altering biosynthetic pathways .
Polyamine transport studies: The MdtJI system provides a model for studying the mechanisms of polyamine transport across bacterial membranes, including structure-function relationships and the role of specific amino acid residues .
Stress response studies: Since mdtJI expression increases under conditions of polyamine stress, it can serve as a reporter for monitoring polyamine-related stress responses .
Pathogenicity research: The link between MdtJI, spermidine levels, and virulence in bacteria like Shigella makes it a valuable tool for studying the role of polyamines in bacterial pathogenesis .
Drug development platform: Understanding how MdtJI exports polyamines could inform the development of inhibitors targeting polyamine transport in pathogenic bacteria, potentially leading to new antimicrobial strategies.
For these applications, researchers typically employ recombinant DNA technologies to express MdtJ with various tags that facilitate detection and purification without compromising function .
E. coli possesses multiple polyamine transport systems that work in concert to maintain polyamine homeostasis:
PotABCD system: Primarily responsible for polyamine uptake, particularly spermidine and putrescine, using ATP-binding cassette (ABC) transporter mechanism .
PotE and CadB: Function as uptake proteins for putrescine and cadaverine, respectively, at neutral pH, but switch to excretion at acidic pH .
MdtJI complex: Functions as a dedicated spermidine exporter at neutral pH, particularly when spermidine levels become excessive .
Metabolic enzymes: Spermidine acetyltransferase provides an alternative mechanism for managing spermidine levels through acetylation, complementing the export function of MdtJI .
This interplay allows for precise regulation of intracellular polyamine levels. When spermidine levels become excessive, MdtJI becomes active to export spermidine, while under polyamine-limiting conditions, uptake systems like PotABCD would predominate. The expression of these systems is regulated in response to environmental conditions and cellular needs, allowing bacteria to maintain optimal polyamine levels for growth while avoiding toxicity due to overaccumulation .
The MdtJI complex appears to play a significant role in bacterial pathogenicity, particularly in Shigella:
Link to virulence regulation: In Shigella, the expression of mdtJI is influenced by VirF, the plasmid-encoded regulator of the Shigella virulence regulatory cascade, suggesting integration with virulence mechanisms .
Response to host environment: The stimulation of mdtJI expression by bile components indicates a specific adaptation to the intestinal environment encountered during infection .
Polyamine homeostasis: The MdtJI complex serves as a "safety valve" allowing Shigella to maintain spermidine at levels optimally suited for survival within infected macrophages while preventing toxicity due to over-accumulation .
Pathoadaptive mutations: The loss of cadaverine and increase of spermidine in Shigella compared to E. coli favor the full expression of Shigella's virulent phenotype, and MdtJI may play a role in maintaining these altered polyamine profiles .
These findings suggest that the MdtJI complex contributes to the pathogenic capabilities of bacteria like Shigella by helping them adapt to the host environment and maintain optimal polyamine levels during infection. This makes MdtJI a potential target for antimicrobial development, particularly for enteric pathogens where polyamine metabolism plays a role in virulence .
The study of MdtJ and the MdtJI complex provides valuable insights into membrane transport mechanisms:
SMR family transporters: As members of the small multidrug resistance family, MdtJ and MdtI serve as models for understanding how relatively small membrane proteins (121 and 109 amino acids, respectively) can form functional transport complexes .
Heteromeric complexes: The requirement for both MdtJ and MdtI for functional transport activity illustrates how heteromeric complexes can achieve substrate specificity and transport efficiency that might not be possible with homomeric transporters .
Structure-function relationships: Identification of critical amino acid residues in both MdtJ and MdtI provides insights into how specific residues contribute to substrate binding, transport, and protein-protein interactions in membrane transporters .
Regulation of transport: The regulation of mdtJI expression by factors such as H-NS, spermidine levels, VirF, and bile components illustrates the complex control mechanisms that govern transporter expression in response to environmental and physiological cues .
Polyamine-specific transport: The specificity of MdtJI for polyamines, particularly spermidine, provides insights into how transporters recognize and translocate highly charged organic cations across hydrophobic membrane barriers .
These insights contribute to our broader understanding of membrane transport processes and may inform the design of drugs targeting bacterial transporters or the development of engineered transport systems for biotechnological applications.
Understanding MdtJ function could lead to several potential antimicrobial strategies:
Direct inhibition of MdtJI: Developing compounds that specifically inhibit the MdtJI complex could potentially disrupt polyamine homeostasis in pathogenic bacteria like Shigella, leading to toxic accumulation of spermidine or deficiency of essential polyamines .
Targeting regulatory pathways: Modulating the expression of mdtJI by targeting regulatory factors such as H-NS or VirF could disrupt polyamine homeostasis and potentially attenuate virulence in pathogenic bacteria .
Polyamine analogs: Designing polyamine analogs that are transported by MdtJI but interfere with polyamine-dependent processes could provide selective toxicity against bacteria with active MdtJI systems.
Combination therapies: Combining inhibitors of polyamine biosynthesis with MdtJI inhibitors could create synergistic effects by simultaneously blocking production and export of polyamines.
Pathogen-specific targeting: Since mdtJI expression differs between commensal E. coli and pathogenic Shigella, targeting the specific regulatory mechanisms in pathogens could potentially allow for selective antimicrobial action against pathogenic strains while sparing commensal bacteria .
These strategies are particularly relevant for enteric pathogens where polyamine metabolism plays a significant role in virulence and adaptation to the host environment .
The recombinant Escherichia coli O9:H4 Spermidine export protein MdtJ has the following structural characteristics:
Amino acid sequence: MYIYWILLGLAIATEGTLSMKWASVSEGGFILMLVMISLSYIFLSFAVKKIALGVAYALWEGIGIFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGAV
Membrane topology: Four transmembrane segments with most functional residues facing the cytoplasm
Critical functional residues: Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82
Protein family: Member of the small multidrug resistance (SMR) family of transporters
Tags: Recombinant MdtJ can be produced with various tags (such as HA3 tag) for detection and purification purposes. The tag type is typically determined during the production process
Storage conditions: Optimal storage is at -20°C, with extended storage at -20°C or -80°C. Working aliquots can be stored at 4°C for up to one week
Buffer compatibility: Typically stored in Tris-based buffer with 50% glycerol, optimized for protein stability
These structural characteristics influence the protein's function as a spermidine exporter and its interaction with MdtI to form a functional transport complex.
Several lines of experimental evidence support the specificity of the MdtJI complex for spermidine export:
Cell viability studies: Expression of mdtJI significantly increased the viability of spermidine acetyltransferase-deficient E. coli cells (strain CAG2242) when cultured with 2 mM spermidine, demonstrating that MdtJI can protect cells from spermidine toxicity .
Polyamine content analysis: When the spermidine and putrescine contents were measured in E. coli CAG2242 cultured with 2 mM spermidine, cells transformed with mdtJI showed significantly reduced intracellular spermidine accumulation compared to control cells, while putrescine levels remained largely unchanged .
Direct transport measurements: Excretion of accumulated [14C]spermidine was observed in cells transformed with pUC mdtJI but not in cells carrying only the vector. This was confirmed by measuring increased spermidine levels in the reaction mixture after removal of cells by centrifugation .
Specificity testing: Among 33 putative drug transporters tested, only the MdtJI complex conferred significant protection against spermidine toxicity, indicating specificity for spermidine export .
Putrescine export: In addition to spermidine, MdtJI has been shown to promote the excretion of putrescine, the spermidine precursor, suggesting broader specificity for polyamines but still within this chemical class .
This body of evidence firmly establishes the MdtJI complex as a dedicated polyamine exporter with primary specificity for spermidine.