Recombinant Escherichia coli O9:H4 Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Production and Purity

Recombinant uspB is produced via bacterial expression systems, primarily in E. coli. Key production parameters include:

ParameterDetailsSource
Expression HostE. coli (e.g., strain HS)
Purity>85% (SDS-PAGE)
Storage ConditionsLiquid: 6 months at -20°C/-80°C; Lyophilized: 12 months at -20°C/-80°C
BufferTris-based buffer with 50% glycerol (common formulation)

Applications in Research

Recombinant uspB is utilized in diverse experimental contexts:

ApplicationDetailsSource
Western BlottingUsed to detect uspB expression in E. coli lysates or purified samples
ELISAServes as an antigen for antibody development or serological studies
Vaccine DevelopmentInvestigated as a potential vaccine candidate for E. coli infections
Stress Response StudiesExamines protein stability under oxidative or osmotic stress conditions

Antigenic Cross-Reactivity

Studies reveal antigenic similarities between E. coli O104 and O9 serogroups, suggesting potential clonal relationships. For example:

  • Anti-O9 Serum: Reacts with O104 antigens at 1:400 dilution, and vice versa .

  • Implications: Cross-reactivity may complicate serotyping but highlights shared evolutionary pathways .

Virulence and Pathogenic Potential

While E. coli O9:H4 is often commensal, strains may harbor diarrheagenic E. coli (DEC) genes:

StrainVirulence GenesPhylogroupsPathotypeSource
O9:H4aggR, aatA, stx2A, B1EAEC/STEC hybrids
O9:(H4, NM)eae, stx1, hlyAA, B1STEC

uspB’s role in stress adaptation may enhance survival in host niches, indirectly contributing to pathogenicity .

Genetic Diversity

  • Serotypes: O9:H4, O9:H7, O9:H21, and others demonstrate diverse antigenic profiles .

  • Phylogenetic Groups: Commensal groups (A, B1) dominate, but pathogenic potential exists .

Supplier and Product Variability

Multiple vendors offer recombinant uspB with distinct specifications:

SupplierProduct CodeProtein LengthTagUniprot IDPurity
CUSABIOCSB-EP422089EJF1PartialN/AA8A5V1>85%
Creative BiolabsVAng-Lsx02693aa 1–111N/AN/AN/A
Creative BiomartRFL20425EFFull-length (1–111)HisB7NNB6>90%

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we can accommodate specific format requests. Please indicate your preference in the order notes section, and we will fulfill your requirements.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: All proteins are standardly shipped with normal blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
uspB; EcHS_A3694; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQV RLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Universal Stress Protein B (uspB) in Escherichia coli?

Universal Stress Protein B (uspB) belongs to a family of closely related proteins found in enteric bacteria, consisting of approximately 110-150 amino acids with 2 transmembrane segments (TMSs). It is expressed during the stationary phase under sigma factor σS control. UspB plays a crucial role in providing resistance to ethanol and various mutagens during the stationary phase of bacterial growth. Additionally, it has been demonstrated to facilitate RuvC resolvase function during DNA repair processes, indicating its importance in stress response mechanisms .

How does UspB differ from other universal stress proteins?

UspB is distinct from other universal stress proteins in several ways. First, it appears to be confined to enteric bacteria, with no homologues identified outside this group . While many universal stress proteins function as cytoplasmic proteins, UspB contains two transmembrane segments, suggesting membrane association. Furthermore, unlike some universal stress proteins that may have roles in transport, UspB's primary function appears to be in DNA repair processes through its interaction with RuvC resolvase, rather than transport activities . This functional specificity distinguishes UspB within the broader universal stress protein family.

What is the regulatory mechanism controlling uspB expression?

The expression of uspB is primarily regulated by the sigma factor σS (RpoS), which controls the general stress response in E. coli during stationary phase. Research has shown that mutations in regulatory genes such as ftsK1 can attenuate the induction of σS-dependent genes, including uspB, during transition to stationary phase . The uspB promoter has been studied for biotechnology applications, demonstrating its utility in controlling recombinant protein expression in high cell density cultivations . The specific regulatory elements within the uspB promoter respond to various stress conditions, particularly those encountered during stationary phase, making it an adaptable system for stress-responsive gene expression.

What are the optimal conditions for expressing recombinant Escherichia coli O9:H4 Universal stress protein B?

For optimal expression of recombinant UspB, a fed-batch cultivation system is recommended based on research utilizing universal stress promoters. The following conditions have demonstrated effective expression:

ParameterOptimal ConditionNotes
Temperature30°CHigher temperatures may induce inclusion body formation
Growth PhaseLate log to early stationaryCapitalizes on natural uspB expression timing
MediumRich medium with controlled carbon sourceEnables high cell density cultivation
InducerNone (stress-induced) or mild ethanol (0.5-1%)Natural stress induction can be supplemented
AerationHigh (>30% dissolved oxygen)Prevents unwanted stress responses
pH7.0-7.2Maintains optimal enzymatic activity

Research by Prytz et al. (2003) demonstrated that the uspB promoter is particularly effective for recombinant protein production in high cell density cultivations, allowing for controlled expression without the need for chemical inducers . The natural induction during stationary phase allows for accumulation of recombinant proteins with reduced metabolic burden during the growth phase.

How should researchers design experiments to study UspB's role in DNA repair mechanisms?

To effectively study UspB's role in DNA repair mechanisms, particularly its interaction with RuvC resolvase, researchers should implement a multi-faceted experimental approach:

  • Gene knockout and complementation studies:

    • Generate uspB deletion mutants using CRISPR-Cas9 or traditional homologous recombination

    • Create complementation strains expressing wildtype or mutated uspB variants

    • Assess DNA repair efficiency following exposure to DNA-damaging agents

  • Protein-protein interaction analysis:

    • Employ co-immunoprecipitation to confirm UspB-RuvC interactions

    • Use bacterial two-hybrid systems to map interaction domains

    • Perform fluorescence resonance energy transfer (FRET) analysis for in vivo interaction confirmation

  • DNA repair assays:

    • Measure survival rates after UV exposure or chemical mutagen treatment

    • Quantify double-strand break repair efficiency

    • Assess Holliday junction resolution in the presence/absence of UspB

This comprehensive approach aligns with methodologies used in Persson et al. (2010), who demonstrated UspB's role in facilitating RuvC resolvase function . The experimental design should include appropriate controls and replicate measurements to ensure statistical significance of observed effects.

How does UspB interact with RuvC resolvase at the molecular level?

The molecular interaction between UspB and RuvC resolvase represents a sophisticated protein-protein relationship critical for DNA repair processes. Based on research by Persson et al. (2010), UspB appears to facilitate RuvC resolvase function through several potential mechanisms :

  • Direct binding and conformational stabilization:

    • UspB may bind directly to RuvC, potentially stabilizing its active conformation

    • This interaction might enhance RuvC's catalytic efficiency at Holliday junctions

  • Membrane localization effects:

    • Given UspB's transmembrane topology, it may help localize DNA repair machinery to specific cellular compartments

    • This compartmentalization could create optimal microenvironments for DNA repair processes

  • Regulatory influence:

    • UspB might modulate RuvC activity in response to stress conditions

    • This regulation could ensure DNA repair processes are coordinated with other stress responses

To fully elucidate these interactions, advanced structural biology approaches such as X-ray crystallography or cryo-electron microscopy of the UspB-RuvC complex would be necessary, combined with molecular dynamics simulations to understand the dynamic aspects of this interaction. Site-directed mutagenesis of key residues in both proteins, followed by functional assays, would help identify critical interaction domains.

What methodologies are most effective for studying UspB membrane topology?

To accurately characterize UspB membrane topology, researchers should employ complementary approaches that validate and extend current understanding of its predicted two transmembrane segments. Effective methodologies include:

TechniqueApplicationAdvantagesLimitations
PhoA/LacZ fusion analysisMap topology through reporter activityWell-established, in vivo approachLimited resolution
Cysteine scanning mutagenesisAccessibility of specific residuesHigh resolution of exposed regionsLabor intensive
Protease protection assaysIdentify protected membrane domainsDirect physical evidenceRequires pure preparations
Cryo-electron microscopyDirect visualization of membrane proteinHigh-resolution structural dataTechnically challenging
Molecular dynamics simulationsPredict membrane interactionsProvides dynamic informationRequires validation

The topology prediction of two transmembrane segments in UspB serves as a starting point, but comprehensive experimental validation is essential. When conducting these studies, researchers should consider the potential impact of the stationary phase cellular environment on membrane composition and protein interactions, as UspB function is specifically linked to stationary phase stress responses.

What is the optimal protocol for purifying recombinant Escherichia coli O9:H4 Universal stress protein B?

For efficient purification of recombinant UspB from E. coli O9:H4, the following optimized protocol is recommended:

  • Expression system preparation:

    • Transform E. coli with an expression vector containing UspB with an affinity tag (His6 or FLAG)

    • Utilize the native uspB promoter or a controllable promoter system

  • Cell growth and induction:

    • Cultivate cells in LB or defined medium at 30°C to OD600 of 0.6-0.8

    • If using an inducible system, add appropriate inducer

    • Continue growth into stationary phase (approximately 12-16 hours)

  • Cell harvesting and lysis:

    • Harvest cells by centrifugation (5,000 × g, 15 min, 4°C)

    • Resuspend in lysis buffer containing:

      • 50 mM Tris-HCl (pH 8.0)

      • 300 mM NaCl

      • 10% glycerol

      • 1 mM PMSF

      • 5 mM β-mercaptoethanol

    • Lyse cells via sonication or pressure-based disruption

  • Membrane fraction isolation:

    • Remove cell debris by centrifugation (10,000 × g, 20 min, 4°C)

    • Ultracentrifuge supernatant (100,000 × g, 1 hour, 4°C) to pellet membranes

    • Solubilize membrane fraction with buffer containing 1% n-dodecyl-β-D-maltoside (DDM)

  • Affinity chromatography:

    • Apply solubilized material to appropriate affinity resin

    • Wash extensively to remove non-specific binding

    • Elute UspB with appropriate elution buffer

  • Polishing steps:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for removal of remaining contaminants

This protocol accommodates UspB's membrane-associated nature through the inclusion of appropriate detergents and membrane fraction isolation steps. Typical yields range from 2-5 mg of purified protein per liter of culture, with >90% purity as assessed by SDS-PAGE.

How can researchers accurately assess UspB's role in ethanol resistance?

To rigorously evaluate UspB's contribution to ethanol resistance in E. coli, researchers should implement a comprehensive experimental framework:

  • Strain preparation:

    • Wild-type E. coli O9:H4

    • uspB knockout mutant

    • Complemented strain (uspB knockout expressing uspB from a plasmid)

    • Overexpression strain (wild-type with additional uspB expression)

  • Ethanol challenge assays:

    • Growth curve analysis in the presence of various ethanol concentrations (0-10%)

    • Survival rate determination after acute ethanol exposure

    • Assessment of recovery capability following ethanol stress

  • Physiological measurements:

    • Membrane integrity evaluation using fluorescent dyes

    • Metabolic activity assessment during ethanol stress

    • Proteomic analysis of stress response activation

  • Data analysis:

    • Determine EC50 values for ethanol tolerance

    • Calculate survival rates at various ethanol concentrations

    • Quantify recovery kinetics following ethanol stress

Farewell et al. (1998) demonstrated that UspB is required for stationary phase resistance to ethanol in E. coli . Building on this finding, researchers should focus on the specific molecular mechanisms underlying this resistance. Comparing multiple strains across different growth phases is essential, as UspB's role is specifically linked to stationary phase resistance rather than log phase tolerance.

How should researchers analyze conflicting data regarding UspB function?

When confronted with conflicting experimental results regarding UspB function, researchers should implement a structured analytical approach:

  • Methodological evaluation:

    • Examine differences in experimental conditions (growth phase, media composition, strain backgrounds)

    • Assess technical aspects (protein expression levels, assay sensitivity, statistical power)

    • Consider potential confounding factors (suppressor mutations, polar effects)

  • Integrative analysis framework:

    • Triangulate findings using multiple methodological approaches

    • Weight evidence based on experimental rigor and reproducibility

    • Develop testable hypotheses that reconcile conflicting observations

  • Systematic validation:

    • Design experiments specifically to address discrepancies

    • Include appropriate controls targeting alternative explanations

    • Collaborate with laboratories reporting conflicting results

For example, if contradictory results emerge regarding UspB's role in DNA repair (as described by Persson et al. 2010) versus potential transport functions (suggested by membrane topology), researchers should carefully examine experimental conditions that might explain the differences. The stationary phase condition might activate different UspB functions compared to exponential growth, or strain-specific differences might alter protein interactions.

What statistical approaches are most appropriate for analyzing UspB mutant phenotypes?

When analyzing UspB mutant phenotypes, researchers should select statistical methods that provide robust analysis while addressing the specific characteristics of stress response data:

Statistical MethodApplicationAdvantages for UspB Research
Two-way ANOVA with post-hoc testsCompare multiple strains across different conditionsAccounts for interaction between genotype and stress conditions
Survival analysis (Kaplan-Meier)Time-to-event data for stress resistanceAppropriate for analyzing bactericidal effects over time
Principal Component AnalysisMultivariate phenotypic dataReveals patterns in complex stress response profiles
Mixed-effects modelsRepeated measures with potential batch effectsAccounts for biological variability between experiments
Bayesian inference approachesIntegration of prior knowledge with new dataParticularly useful when building on established UspB functions

How can the uspB promoter be optimized for recombinant protein expression systems?

The uspB promoter offers unique advantages for recombinant protein expression, particularly in applications requiring stationary phase production without chemical inducers. Based on research by Prytz et al. (2003), the following optimizations can enhance uspB promoter performance :

  • Promoter engineering:

    • Identification and modification of key regulatory elements

    • Creation of synthetic promoter variants with enhanced activity

    • Development of hybrid promoters combining uspB elements with other regulatory sequences

  • Culture condition optimization:

    • Fed-batch strategies tailored to uspB activation kinetics

    • Precise control of carbon source availability to trigger promoter activation

    • Environmental stress modulation to enhance expression levels

  • Expression system design:

    • Vector optimization for copy number and stability

    • Codon optimization of target genes for E. coli expression

    • Incorporation of additional regulatory elements for fine-tuned control

This approach has been successfully implemented for recombinant β-galactosidase production in high cell density cultivations . The uspB promoter system is particularly valuable when expression during stationary phase is desirable, such as for proteins that might be toxic during active growth or when downstream processing benefits from increased cell density prior to harvest.

How can UspB research contribute to understanding bacterial stress response networks?

UspB research provides a valuable model for understanding integrated stress response networks in bacteria, with several key contributions:

  • Stationary phase adaptation mechanisms:

    • UspB exemplifies the specialized proteins activated during stationary phase

    • Its dual roles in ethanol resistance and DNA repair illustrate the multifunctional nature of stress proteins

    • Studies of UspB regulation reveal how bacteria prioritize different protective mechanisms

  • Membrane-associated stress responses:

    • UspB's membrane topology suggests compartmentalized stress responses

    • This provides insights into how membrane integrity is maintained during stress

    • Understanding these mechanisms could reveal new targets for antimicrobial development

  • Sigma factor networks:

    • UspB's regulation by σS demonstrates how global regulators orchestrate stress adaptation

    • The interaction between the UspB and RuvC systems illustrates cross-talk between different stress response pathways

    • This network approach is critical for comprehensive understanding of bacterial adaptation

Research examining how UspB integrates with other stress response proteins could elucidate broader principles of bacterial stress adaptation. The finding that UspB facilitates RuvC resolvase function during DNA repair demonstrates how stress response systems can be functionally interconnected rather than operating as isolated pathways. This systems biology perspective on UspB function has implications for understanding bacterial persistence, antibiotic tolerance, and evolution of stress resistance.

What are the most promising approaches for studying UspB homologs in other enteric bacteria?

To advance understanding of UspB across enteric bacteria, researchers should pursue several complementary approaches:

  • Comparative genomics and evolutionary analysis:

    • Conduct comprehensive sequence analysis of UspB across enterobacterial species

    • Reconstruct the evolutionary history of UspB within the family Enterobacteriaceae

    • Identify signature sequences that might correlate with functional specialization

  • Functional conservation assessment:

    • Express heterologous UspB proteins in E. coli uspB mutants to test complementation

    • Evaluate cross-species functionality in ethanol resistance and DNA repair

    • Identify species-specific variations in UspB function

  • Structural biology approaches:

    • Determine structures of UspB proteins from diverse enteric bacteria

    • Compare membrane topology and protein interaction surfaces

    • Identify conserved functional domains versus variable regions

The observation that UspB appears confined to enteric bacteria raises intriguing questions about its evolutionary origin and functional specialization. By systematically comparing UspB proteins across species, researchers can gain insights into both fundamental stress response mechanisms and the evolution of specialized adaptation systems within enteric bacteria.

What novel experimental techniques might advance understanding of UspB's molecular mechanisms?

Emerging technologies offer exciting opportunities to elucidate UspB's molecular mechanisms with unprecedented precision:

TechniqueApplication to UspB ResearchPotential Insights
Cryo-electron tomographyVisualize UspB in native membrane environmentSpatial organization and protein complexes
Single-molecule FRETMonitor UspB-RuvC interactions in real-timeDynamic aspects of protein interactions
CRISPR interferencePrecise temporal control of uspB expressionTiming-dependent functions in stress response
Proximity labeling (BioID/APEX)Identify UspB interaction partners in vivoComprehensive protein interaction network
Native mass spectrometryCharacterize intact UspB complexesStoichiometry and stability of protein assemblies
Microfluidic stress response assaysSingle-cell analysis of UspB functionHeterogeneity in stress response activation

These advanced approaches could resolve longstanding questions about UspB function. For example, single-cell techniques could determine whether UspB-mediated protection is uniform across a population or creates subpopulations with differential stress resistance. Similarly, structural studies might reveal how UspB's transmembrane domains contribute to its function in facilitating RuvC resolvase activity during DNA repair .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.