Recombinant Escherichia coli O9:H4 UPF0059 membrane protein yebN (yebN)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O9:H4 UPF0059 Membrane Protein YebN

Recombinant Escherichia coli O9:H4 UPF0059 membrane protein YebN (UniProt ID: B1XH88) is a full-length, His-tagged protein expressed in E. coli for structural and functional studies. YebN belongs to the UPF0059 family of uncharacterized membrane proteins, which are conserved across Gram-negative bacteria. This protein is implicated in membrane-associated processes, though its precise biological role in E. coli remains under investigation .

Key Properties:

PropertyDetail
OrganismEscherichia coli O9:H4 (strain-specific data not fully resolved in literature)
GeneyebN
Protein Length188 amino acids
Expression SystemE. coli prokaryotic system
TagN-terminal His tag
Purity>90% (verified by SDS-PAGE)
Concentration1–2 mg/mL after purification

The recombinant YebN is produced via codon-optimized expression vectors in E. coli, followed by affinity chromatography purification. While strain O9:H4 is specified in the query, most available data derive from studies on E. coli O78 or other serotypes due to limited direct reports on O9:H4 .

3.1. Putative Roles in Membrane Biology

YebN is annotated as a membrane protein with a conserved DUF204 domain, though its exact function in E. coli is not fully characterized. Homologs in related bacteria suggest potential roles in:

  • Metal ion homeostasis: A Xanthomonas oryzae YebN homolog acts as a manganese efflux system critical for oxidative stress resistance and virulence .

  • Membrane protein biogenesis: UPF0059 family proteins may assist in membrane insertion or lipid organization, akin to YibN (a YidC interactor in E. coli) .

4.2. Biochemical Assays

  • Membrane protein interaction studies: YebN’s His tag facilitates pull-down assays to identify binding partners .

  • Lipid scramblase activity: Related UPF0059 proteins influence membrane lipid distribution, suggesting YebN could be tested in similar assays .

Challenges and Knowledge Gaps

  • Strain-specific discrepancies: Most functional data for YebN derive from non-O9:H4 E. coli strains or other bacterial species, necessitating validation in O9:H4 contexts.

  • Mechanistic ambiguity: The lack of resolved 3D structures or knockout studies limits mechanistic insights.

Future Directions

  1. Structural resolution: Cryo-EM or X-ray crystallography to determine YebN’s membrane topology.

  2. Knockout phenotyping: Assess growth defects, metal sensitivity, or virulence in yebN-null E. coli.

  3. Cross-species functional studies: Compare YebN’s role in E. coli with its homolog in Xanthomonas .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
mntP; yebN; EcHS_A1911; Probable manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
mntP
Target Protein Sequence
MNITATVLLAFGMSMDAFAASIGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG
Uniprot No.

Target Background

Function

This protein likely functions as a manganese efflux pump.

Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How can I confirm the outer membrane localization of recombinant YebN in E. coli?

Confirmation of outer membrane localization requires a systematic fractionation approach. Begin with a two-step protocol combining successive sucrose gradient centrifugation steps (two-step followed by six-step gradients) to separate inner and outer membranes. Verify fraction purity by Western blotting against established markers such as OmpA (outer membrane) and Lep (inner membrane). To definitively distinguish between true membrane integration and co-sedimentation with membrane fractions, implement a 5M urea wash protocol on the purified outer membrane fraction. This treatment dissolves potential protein aggregates while leaving properly inserted membrane proteins intact. Properly inserted outer membrane proteins will remain in the membrane pellet after urea treatment, while inclusion body proteins (which can be detected using IbpA,B antibodies) will solubilize .

What expression vectors are most suitable for recombinant membrane protein production in E. coli?

For membrane protein expression, pET-based vectors offer robust control of expression levels under the T7 promoter system. These vectors, such as pET28a+, are particularly valuable when combined with E. coli BL21(DE3) host strains that contain the chromosomally integrated T7 RNA polymerase gene under lacUV5 control . When working with membrane proteins like YebN, adding purification tags becomes an important consideration. The pET28a+ plasmid allows incorporation of N-terminal His-tags, which not only facilitates purification but can significantly enhance expression levels by at least 1.5-fold compared to untagged constructs, likely due to favorable alterations in mRNA secondary structure at the 5' region . For membrane proteins that may form inclusion bodies, the pING vector system with controllable arabinose-inducible promoters offers an alternative that allows modulation of expression rates .

How does E. coli strain selection impact membrane protein expression?

E. coli BL21(DE3) remains the workhorse strain for recombinant protein expression, including membrane proteins. This strain's deficiency in lon and ompT proteases reduces degradation of target proteins. For membrane proteins like YebN that may stress the cellular machinery, consider specialized strains like C41(DE3) or C43(DE3) that have adapted to tolerate membrane protein overexpression. When evaluating strain performance, monitor not only protein yield but also plasmid stability during cultivation, as rapid plasmid loss can indicate toxicity of the expressed membrane protein to the host. Quantify both parameters throughout the cultivation process, particularly after induction . Be aware that membrane protein expression characteristics vary between native and laboratory E. coli strains - proteins like MatB (formerly annotated as YagZ) express in pathogenic strains but not in K12 laboratory strains .

What are the key factors affecting membrane protein solubility versus inclusion body formation?

Several critical factors determine whether membrane proteins integrate into membranes or form inclusion bodies. Expression rate is paramount - rapid accumulation of membrane proteins often overwhelms the membrane insertion machinery. Control this by adjusting inducer concentrations and induction temperature. The SecB chaperone plays a crucial role in targeting most outer membrane proteins (including experimentally verified proteins like YftM, YaiO, YfaZ, CsgF, and YliI); thus, maintaining proper chaperone availability is essential. Monitoring inclusion body formation can be accomplished by tracking inclusion body-binding proteins (IbpA/B) via Western blotting after cell fractionation. Proteins that completely dissolve in 5M urea treatment after fractionation likely represent inclusion bodies rather than true membrane insertions .

How can I optimize the mRNA secondary structure of the yebN gene to improve expression in E. coli?

Optimization of mRNA secondary structure, particularly in the translation initiation region (TIR), represents a powerful strategy for enhancing membrane protein expression. Begin by conducting in silico analysis of the current construct using computational tools like TIsigner and RNAfold to evaluate the 5' mRNA opening energy and secondary structure. For optimal translation efficiency, target a reduction in the complexity of secondary structures in the -30 to +30 region surrounding the start codon, as stable hairpins in this region can impede ribosome binding and translation initiation .

A methodical approach involves:

  • Analyze the current construct's minimum free energy (MFE) secondary structure using RNAfold.

  • Calculate the opening energy using TIsigner (optimal values being lower than 10 kcal/mol).

  • Design synonymous mutations in the 5' region that preserve amino acid sequence while reducing secondary structure complexity.

  • Compare predicted expression scores before implementation.

Experimental data demonstrates that reductions in 5' mRNA opening energy correlate strongly with increased protein production. For example, a modified gene version with opening energy of 9.8 kcal/mol (and expression score of 83.27) showed significantly higher protein production than versions with more complex secondary structures . This approach represents a rational design strategy that can be implemented prior to experimental work, potentially saving considerable optimization time.

What methodological approaches can be used to identify novel membrane proteins like YebN through bioinformatics?

The identification of novel membrane proteins through bioinformatics represents a complementary approach to traditional proteomics methods, particularly valuable for proteins with low abundance or condition-specific expression. Implementation of a systematic bioinformatics-guided discovery pipeline begins with sequence-based prediction using specialized algorithms designed for β-barrel outer membrane proteins .

The process involves:

  • Apply specialized prediction tools such as the Hunter predictor to identify candidate outer membrane proteins in the unannotated portion of the E. coli proteome.

  • Prioritize candidates based on prediction scores and structural characteristics (predicted β-strand numbers, protein length).

  • Clone selected candidates into expression vectors with C-terminal epitope tags (such as HA) for immunodetection.

  • Verify membrane localization experimentally through sucrose gradient centrifugation and urea extraction protocols.

  • Confirm SecA-dependent translocation by pulse-labeling experiments with [35S]-Met in the presence and absence of sodium azide.

This approach has been successfully employed to identify and confirm five previously unannotated outer membrane proteins in E. coli (YftM, YaiO, YfaZ, CsgF, and YliI), demonstrating its efficiency over traditional proteomics approaches for low-abundance membrane proteins .

How can I determine if a membrane protein functions as an autotransporter?

Autotransporters represent a specialized class of outer membrane proteins featuring a C-terminal translocator domain and an N-terminal passenger domain with specific functions. To determine if YebN or other membrane proteins function as autotransporters, implement a multi-faceted experimental approach :

  • Molecular Weight Analysis: Compare the predicted molecular weight of the full-length protein with observed bands on SDS-PAGE. The presence of a cleaved fragment (~55 kDa for known autotransporters) in whole-cell lysates but not in purified membrane fractions suggests autoproteolytic processing.

  • Inhibitor Studies: Test whether serine/threonine protease inhibitors (e.g., Pefabloc SC) prevent the appearance of the cleaved band, as many autotransporters possess serine protease activity.

  • Domain-specific Tagging: Use C-terminal tagging to monitor the fate of the translocator domain and N-terminal tagging to track the passenger domain.

  • Functional Assays: Depending on predicted functions, implement cell adhesion or enzymatic activity assays for the passenger domain.

This approach successfully identified YfaL as a potential autotransporter in E. coli, where a 55 kDa C-terminal fragment appeared after expression, and this cleavage was inhibited by Pefabloc SC .

What techniques enable effective analysis of the SecB-dependent translocation of membrane proteins?

The SecB chaperone plays a critical role in outer membrane protein biogenesis. Analysis of SecB-dependency for membrane proteins like YebN can be accomplished through several complementary approaches:

  • Pulse-Chase Experiments: Conduct [35S]-Met pulse-labeling followed by immunoprecipitation in both wild-type and SecB-deficient strains. Compare the appearance of mature versus pre-protein forms.

  • Sodium Azide Inhibition: Block SecA-dependent translocation through the inner membrane SecYEG translocon by adding sodium azide prior to pulse-labeling. An accumulation of higher molecular-weight precursor forms indicates SecA-dependent translocation .

  • Double-Band Analysis: When expressed membrane proteins appear as doublets on SDS-PAGE, the higher molecular weight band often represents the non-processed precursor (with signal peptide), while the lower band represents the mature protein. The ratio between these bands provides information about translocation efficiency .

  • Complementation Studies: Express the membrane protein in SecB-deficient strains with plasmid-based SecB complementation to confirm direct dependency.

Research indicates that most outer membrane proteins, including experimentally verified ones like YftM, YaiO, YfaZ, CsgF, and YliI, share SecB-dependent translocation as a common characteristic . This property can be exploited for optimizing expression conditions.

How can mRNA structure analysis be integrated into experimental design for membrane protein expression?

A comprehensive experimental design approach for membrane protein expression should integrate mRNA structure analysis as a predictive tool. Implementation follows these methodological steps:

This integrated approach can significantly reduce optimization time by starting with rationally designed constructs more likely to achieve high expression levels.

What are effective cultivation strategies for maximizing membrane protein yields in E. coli?

Optimizing cultivation conditions for membrane protein expression requires balancing protein synthesis rates with the cell's capacity for proper membrane insertion. A systematic approach involves:

  • Media Optimization: Define media composition based on the specific requirements of the expression system. Complex media generally support higher biomass but may result in more inclusion body formation for membrane proteins. Defined media allow better control of metabolic rates.

  • Induction Parameters: For membrane proteins, lower induction temperatures (16-25°C) often improve folding and membrane insertion. Determine optimal inducer concentration experimentally, as membrane proteins typically benefit from lower concentrations to prevent overwhelming the membrane insertion machinery.

  • Bioreactor Operation: When scaling to bioreactors (e.g., 10L scale), implement controlled feeding strategies to maintain growth rates below critical thresholds that lead to inclusion body formation. Monitor dissolved oxygen levels carefully, as oxygen limitation can drastically affect membrane protein insertion pathways .

  • Process Monitoring: Throughout cultivation, monitor not only protein production but also plasmid stability, as loss of expression plasmids is a common issue with toxic membrane proteins. Additionally, track carbon source utilization and acetic acid formation as indicators of metabolic stress .

  • Harvest Timing: Determine optimal harvest points by time-course analysis of target protein in membrane fractions versus inclusion bodies.

This comprehensive approach maximizes the likelihood of successful membrane protein expression while minimizing troubleshooting time.

How can I troubleshoot poor membrane insertion of recombinant YebN protein?

Troubleshooting membrane protein insertion issues requires systematic investigation of multiple factors:

  • Expression Rate Analysis: Too rapid accumulation overwhelms membrane insertion machinery. Perform time-course experiments following induction, analyzing both membrane fractions and inclusion body formation. Adjust inducer concentration and temperature if rapid accumulation occurs before membrane insertion.

  • Chaperone Co-expression: Consider co-expressing SecB or other specific chaperones to enhance proper folding and targeting. SecB dependency has been established for multiple outer membrane proteins .

  • Signal Sequence Evaluation: For proteins showing inefficient processing (appearing as doublets on SDS-PAGE), evaluate signal sequence efficiency. Consider testing alternative signal sequences from well-expressed E. coli membrane proteins.

  • Proteolytic Degradation Assessment: Distinguish between poor membrane insertion and rapid degradation after insertion. Perform pulse-chase experiments in protease-deficient strains compared to standard expression strains.

  • Strain Compatibility: Test expression in specialized membrane protein expression strains (C41/C43) that have adapted to accommodate membrane protein overexpression.

  • mRNA Structure Optimization: Apply mRNA secondary structure analysis as described previously to identify potential translation initiation barriers .

By systematically addressing these factors, researchers can significantly improve membrane insertion efficiency for challenging membrane proteins like YebN.

How should I interpret and analyze membrane protein fractionation data?

Proper interpretation of membrane fractionation data is critical for confirming localization of proteins like YebN. Apply this analytical framework:

  • Marker Protein Controls: Always run parallel Western blots for established marker proteins (e.g., OmpA for outer membranes, Lep for inner membranes, IbpA/B for inclusion bodies) to validate fraction purity.

  • Cross-contamination Assessment: When target proteins appear in multiple fractions, determine if this represents true dual localization or cross-contamination. Trace amounts of strongly expressed proteins like YaiO and YliI in inner membrane fractions often indicate cross-contamination rather than dual localization .

  • Oligomeric State Analysis: For membrane proteins showing higher molecular weight bands (like YtfM forming apparent dimers at ~150 kDa), evaluate whether these represent SDS-resistant oligomers versus aggregates through treatments with various detergents and reducing agents.

  • Urea Extraction Interpretation: After treating outer membrane fractions with 5M urea, proteins remaining in the pellet can be confidently assigned as membrane-integrated. Those extracted into the supernatant likely represent aggregates or peripherally associated proteins .

  • Quantitative Analysis: Apply densitometry to determine the distribution ratio of target proteins across fractions, normalizing to total protein or marker protein levels in each fraction.

What approach should I take to analyze the impact of mRNA structure on membrane protein expression?

Analysis of mRNA structure impact on membrane protein expression requires integration of computational predictions with experimental data:

  • Structure Prediction Analysis: Generate minimum free energy (MFE) secondary structure models for the translation initiation region (-30 to +30 surrounding the start codon) using tools like RNAfold. Identify structures that may impede ribosome binding, particularly stem structures that sequester the Shine-Dalgarno sequence or start codon.

  • Opening Energy Quantification: Calculate the opening energy values using tools like TIsigner. Lower values (<10 kcal/mol) correlate with higher expression potential .

  • Comparative Analysis: When multiple gene versions exist (with or without tags, or with synonymous mutations), compare both predicted structural elements and opening energy values against experimental expression data to identify patterns.

  • Statistical Validation: Apply statistical methods to establish correlations between predicted structural features and experimental protein yields across multiple constructs or conditions.

  • Production Parameter Integration: Correlate mRNA structural features with broader cultivation parameters such as growth rates, plasmid stability, and metabolic indicators to develop predictive models for expression optimization .

This analytical approach transforms mRNA structure from a qualitative consideration into a quantitative parameter for expression optimization.

What biosafety considerations apply when working with recombinant E. coli strains expressing membrane proteins?

Working with recombinant E. coli strains, particularly those derived from pathogenic serotypes like O9:H4, requires adherence to appropriate biosafety protocols:

Adherence to these biosafety principles ensures responsible research while minimizing risks associated with recombinant membrane protein expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.