Recombinant Escherichia coli O9:H4 UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli O9:H4 UPF0208 Membrane Protein YfbV (yfbV)

The protein YfbV is a membrane protein found in Escherichia coli. Research suggests it has roles in cell division and adherence . Furthermore, overexpression studies indicate that membrane proteins such as YfbV might not always fold correctly when targeted to E. coli membranes .

Characteristics of Escherichia coli O9:H4

Escherichia coli ( E. coli) O9:H4 is a serotype of E. coli . Serotyping of E. coli O9 has identified nine different serotypes . E. coli O9:H4 can be a diarrheagenic E. coli .

The Role of YfbV in Cell Division and Adhesion

YfbV was initially identified in a genome-wide screen for its ability to inhibit cell division, leading to the formation of filamentous cells when expressed at high levels in E. coli . It localizes to the cell division site and exhibits some specificity for glycan binding . YtfB, which shares homology with the virulence factor OapA in Haemophilus influenzae, binds with high affinity to N’acetylglucosamine and mannobiose glycans . Studies using the uropathogenic E. coli strain UTI89 have shown that the absence of ytfB reduces the bacteria's ability to adhere to kidney cells, but not bladder cells, suggesting a specific role in the early stages of ascending urinary tract infections .

YfbV Interactions with Other Proteins

Research has indicated that YtfB interacts with proteins involved in cellular function and with hypothetical fimbrial-like proteins YbgP, YbgD, and YgiL . Additionally, YfbV may interact with the cell division protein DamX .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
yfbV; EcHS_A2444; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for recombinant YfbV production?

For recombinant production of YfbV, E. coli-based expression systems remain the gold standard for prokaryotic membrane proteins. The BL21(DE3) strain combined with pET vector systems offers high yield potential. Consider these methodological approaches:

Expression SystemAdvantagesLimitationsRecommended Tags
E. coli BL21(DE3)High yield, economical, rapid growthPotential inclusion body formationHis6, MBP
C41/C43(DE3)Optimized for membrane proteinsLower yield than BL21His6, SUMO
Lemo21(DE3)Tunable expressionRequires optimizationHis6
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldHis6, Strep-tag

Expression should be optimized by testing various induction temperatures (16-37°C), IPTG concentrations (0.1-1.0 mM), and induction times (4-24 hours). For YfbV specifically, pilot experiments suggest that lower temperatures (16-20°C) with longer induction times may improve proper membrane integration .

What are the recommended storage conditions for purified YfbV protein?

Purified YfbV should be stored in a Tris-based buffer with 50% glycerol for stability. The manufacturer's recommendations indicate storage at -20°C for regular use, while extended storage should be at -20°C or -80°C to maintain protein integrity. Importantly, repeated freeze-thaw cycles significantly reduce activity and should be avoided; working aliquots can be maintained at 4°C for up to one week .

For research requiring extended protein stability, consider these evidence-based preservation strategies:

  • Add stabilizing agents such as glycerol (10-50%), sucrose (5-20%), or specific detergents

  • Maintain pH between 7.0-8.0 using Tris or phosphate buffers

  • Include reducing agents (1-5mM DTT or 1-2mM β-mercaptoethanol) if cysteine residues are present

  • For long-term storage, flash freeze small aliquots in liquid nitrogen before transferring to -80°C

How can I determine the membrane topology of YfbV?

Determining the membrane topology of YfbV requires a multi-method approach. Begin with computational predictions using tools like TMHMM, HMMTOP, and TopPred, which analyze the amino acid sequence for hydrophobic segments and following the positive-inside rule.

For experimental validation, consider these techniques:

  • Substituted cysteine accessibility method (SCAM): Introduce cysteine residues at various positions and test accessibility to membrane-impermeable sulfhydryl reagents

  • Protease protection assays: Treat membrane vesicles with proteases and analyze protected fragments

  • Fluorescence quenching: Attach fluorophores to specific residues and measure accessibility to quenchers

  • Epitope insertion and antibody binding: Insert epitope tags at various positions and test antibody accessibility in membrane-permeabilized versus intact cells

Each method has specific requirements:

MethodKey ReagentsControls NeededAnalysis Approach
SCAMMaleimide reagents, cysteine-free base proteinCysteine-less control, permeabilized samplesMass spectrometry, fluorescence
Protease protectionTrypsin, chymotrypsinDetergent-solubilized samplesWestern blot, mass spectrometry
Fluorescence quenchingFluorophores, collisional quenchersSolubilized proteinStern-Volmer plots
Epitope mappingHA, FLAG, or c-Myc tagsPermeabilized controlsImmunofluorescence, flow cytometry

What approaches can identify potential interaction partners of YfbV?

To identify YfbV protein-protein interactions, employ a combination of in vitro and in vivo techniques:

  • Co-immunoprecipitation (Co-IP): Use anti-YfbV antibodies or antibodies against the recombinant tag to pull down protein complexes from cell lysates, followed by mass spectrometry

  • Bacterial two-hybrid system: Particularly useful for membrane proteins, testing potential interactions in a cellular context

  • Pull-down assays: Immobilize purified YfbV on resin via its tag and incubate with cell lysates

  • Crosslinking mass spectrometry: Use membrane-permeable crosslinkers like DSP or formaldehyde to capture transient interactions

  • Proximity labeling: Fuse YfbV to BioID or APEX2 to biotinylate proximal proteins

For each interaction identified, validation experiments should include:

  • Reciprocal pull-downs

  • Domain mapping to identify interaction regions

  • Competition assays with purified components

  • Functional assays to demonstrate biological relevance

How can I analyze YfbV's role in membrane dynamics and organization?

YfbV's role in membrane dynamics can be investigated through various biophysical and imaging approaches:

  • Fluorescence recovery after photobleaching (FRAP): Fuse YfbV to GFP and measure lateral mobility within the membrane

  • Förster resonance energy transfer (FRET): Assess proximity relationships with other membrane components

  • Giant unilamellar vesicles (GUVs): Reconstitute YfbV in artificial membrane systems to study its effect on membrane curvature and domain formation

  • Cryo-electron microscopy: Visualize YfbV arrangements within the membrane at near-atomic resolution

Methodological workflow should include:

  • Construct fluorescent protein fusions ensuring proper membrane localization

  • Confirm fusion protein functionality through complementation assays

  • Employ super-resolution microscopy (STORM, PALM) to visualize nanoscale organization

  • Correlate localization patterns with specific membrane lipid compositions using lipid-binding probes

What are the optimal conditions for solubilizing and purifying YfbV?

Membrane protein solubilization requires careful detergent selection. For YfbV, a systematic approach should test multiple detergent classes:

Detergent ClassExamplesCMC RangeRecommended Starting Concentration
Mild non-ionicDDM, LMNG0.01-0.2 mM1-2% for extraction, 2-3× CMC for purification
ZwitterionicLDAO, FC-121-4 mM1-2% for extraction, 3-5× CMC for purification
GlycosidesOG, NG18-25 mM2% for extraction, 3-4× CMC for purification
AmphipolsA8-35, PMALN/A1:3 protein:amphipol ratio

For purification, employ a multi-step approach:

  • Initial capture via affinity chromatography (IMAC for His-tagged constructs)

  • Size exclusion chromatography to remove aggregates and assess oligomeric state

  • Optional ion exchange step for removing contaminants

Quality control should include SDS-PAGE, Western blotting, and dynamic light scattering to assess purity, identity, and monodispersity respectively .

How can I develop reliable functional assays for YfbV?

Since the specific function of YfbV is not fully characterized, a comprehensive functional assessment approach is recommended:

  • Lipid binding assays: Test binding to various lipids using liposome flotation or lipid overlay assays

  • Ion flux measurements: Reconstitute YfbV in liposomes loaded with fluorescent indicators to detect potential channel/transporter activity

  • Growth complementation: Construct deletion strains and test whether YfbV expression rescues phenotypes

  • Stress response analysis: Examine changes in expression under various stress conditions (pH, temperature, osmotic shock)

Each assay should include appropriate controls:

  • Negative controls: Empty vectors, inactive mutants

  • Positive controls: Well-characterized proteins with similar predicted functions

  • Specificity controls: Related proteins from the same family to determine functional uniqueness

What approaches work best for structure-function analysis of YfbV?

Structure-function analysis requires systematic mutagenesis combined with functional readouts:

  • Alanine scanning: Replace conserved residues with alanine to identify functional hotspots

  • Domain swapping: Exchange domains with homologous proteins to map functional regions

  • Cysteine crosslinking: Introduce pairs of cysteines to constrain conformational dynamics

  • Truncation analysis: Create N- and C-terminal truncations to identify minimal functional units

Data analysis should correlate structural features with functional outcomes:

Mutation TypeDesign StrategyFunctional AssessmentStructural Interpretation
Conserved residuesSequence alignment across homologsActivity assaysCritical functional sites
Charged clustersFocus on membrane-proximal regionsLocalization, complex formationProtein-protein interaction sites
Hydrophobic patchesSurface mappingMembrane associationLipid interaction surfaces
Glycine/prolineTarget potential hinge regionsConformational dynamicsFlexibility requirements

How does YfbV compare to other UPF0208 family proteins?

The UPF0208 family remains largely uncharacterized, making comparative analysis particularly valuable. Perform sequence and structural comparisons across bacterial species to identify:

  • Conserved sequence motifs that may indicate functional domains

  • Evolutionary patterns suggesting co-evolution with interaction partners

  • Gene neighborhood analysis to identify potential functional associations

A methodological approach should include:

  • Multiple sequence alignment using MUSCLE or MAFFT

  • Phylogenetic tree construction using maximum likelihood methods

  • Conservation mapping onto predicted structural models

  • Comparative genomic analysis using tools like STRING database

What techniques are most effective for studying YfbV expression and regulation?

To study YfbV expression and regulation, employ these approaches:

  • Promoter fusion assays: Fuse the yfbV promoter to reporter genes (GFP, lacZ) to monitor expression under different conditions

  • qRT-PCR: Quantify yfbV transcript levels in response to environmental stimuli

  • ChIP-seq: Identify transcription factors binding to the yfbV promoter region

  • RNA-seq: Compare transcriptomes between wild-type and yfbV deletion strains

For experimental design, consider:

  • Testing conditions relevant to E. coli physiology (nutrient limitation, pH changes, antibiotic stress)

  • Including appropriate time courses to capture dynamic regulation

  • Using multiple strains (laboratory, clinical isolates) to assess strain-specific regulation

  • Correlating expression with phenotypic assays to determine functional consequences

How might YfbV contribute to bacterial membrane homeostasis?

Based on its membrane localization and protein family, YfbV may play roles in:

  • Membrane integrity maintenance during environmental stress

  • Protein complex scaffolding at specific membrane regions

  • Small molecule transport or sensing

  • Cell division processes through localization at division sites

Experimental approaches to test these hypotheses:

  • Membrane integrity assays using fluorescent dyes in wild-type versus deletion strains

  • Lipidomic analysis to detect changes in membrane composition

  • Localization studies during cell cycle and under various stresses

  • Metabolomic analysis to identify potential transported substrates

What are the recommended approaches for developing inhibitors or modulators of YfbV function?

For researchers interested in developing molecular tools to probe YfbV function:

  • Fragment-based screening: Test libraries of small molecules for binding to purified YfbV

  • In silico docking: Use homology models to identify potential binding pockets

  • Peptide-based inhibitors: Design peptides mimicking interaction interfaces

  • Genetic suppressor screening: Identify mutations that enhance or suppress yfbV deletion phenotypes

A systematic workflow should include:

  • Target validation through genetic and biochemical approaches

  • Primary screening assays with appropriate controls

  • Secondary assays to confirm specificity and mechanism

  • Structure-activity relationship studies for promising leads

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.