Recombinant Escherichia coli O9:H4 UPF0283 membrane protein ycjF (ycjF)

Shipped with Ice Packs
In Stock

Description

General Information

The protein "Recombinant Escherichia coli O9:H4 UPF0283 membrane protein YcjF (YcjF)" refers to a protein produced using recombinant DNA technology in Escherichia coli ( E. coli) . E. coli is often employed as a host for the heterologous synthesis of various membrane proteins due to its rapid growth rate, ease of genetic manipulation, and cost-effectiveness .

  • UPF0283 membrane protein YcjF: This is a specific membrane protein found in E. coli . The "UPF0283" indicates that it belongs to a protein family of unknown function (UPF), with "0283" being a specific identifier for this family member. YcjF is the name of the protein.

  • O9:H4: This refers to the serotype of E. coli, based on its O (lipopolysaccharide) and H (flagellar) antigens .

Role of E. coli in Membrane Protein Production

E. coli is a widely used bacterium for recombinant protein production, particularly for membrane proteins . Its genetic tractability allows for the screening of various gene constructs to optimize expression conditions, resulting in relatively high yields of membrane proteins in a short time .

Membrane Proteins in E. coli

Membrane proteins play essential roles in various cellular functions, including signal transduction, apoptosis, and metabolism .

YhaJ Regulator in E. coli

YhaJ is a transcriptional regulator in E. coli that coordinates the expression of virulence and metabolic genes . It plays a crucial role in the systemic survival of uropathogenic E. coli (UPEC) during bloodstream infection by coordinating the activation of fimbriae and the biosynthesis of tryptophan . Deletion of yhaJ results in a mutant that is significantly outcompeted by the wild type during bloodstream infection, with reduced colonization of the spleen and liver .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is assigned during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ycjF; EcHS_A1437; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAQEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWRRLWRLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Escherichia coli O9:H4 UPF0283 membrane protein YcjF?

YcjF is a membrane protein encoded by the ycjF gene in Escherichia coli O9:H4 (strain HS). It is classified as an UPF0283 family protein (Uncharacterized Protein Family 0283), with a UniProt accession number A7ZZR4. The protein consists of 353 amino acids and is predicted to be localized in the bacterial membrane. Though its specific function remains to be fully characterized, it belongs to a genomic cluster that includes other characterized proteins like YcjQ and YcjS, which function as dehydrogenases involved in carbohydrate metabolism .

How should recombinant YcjF protein be stored for optimal stability?

For optimal stability of recombinant YcjF protein, store the stock solution at -20°C, and for extended storage, conserve at -80°C. The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein. It's important to note that repeated freezing and thawing is not recommended as it can lead to protein degradation and loss of activity. For working solutions, store aliquots at 4°C for up to one week to maintain protein integrity. When preparing aliquots, use sterile conditions and divide the stock into small volumes to minimize freeze-thaw cycles .

What expression systems are recommended for producing recombinant YcjF protein?

For producing recombinant YcjF protein, a heterologous expression system using E. coli BL21(DE3) or similar strains is commonly employed. The workflow should include:

  • Cloning Strategy:

    • Amplify the ycjF gene from E. coli O9:H4 genomic DNA

    • Clone into a pET-based expression vector with a suitable tag (His6 or MBP)

    • Validate the construct by sequencing

  • Expression Conditions:

    • Transform into expression host

    • Culture in LB or 2xYT medium at 37°C until OD600 reaches 0.6-0.8

    • Induce with 0.5-1.0 mM IPTG

    • Lower temperature to 18-25°C post-induction

    • Continue expression for 16-18 hours

  • Membrane Protein Considerations:

    • Add membrane-stabilizing agents (glycerol 5-10%)

    • Consider adding specific detergents (0.05-0.1% DDM or LDAO) during cell lysis

This approach accounts for the challenges of membrane protein expression, balancing protein yield with proper folding and membrane integration .

What purification protocol should be followed for isolating YcjF from recombinant sources?

A robust purification protocol for YcjF should include:

StepProcedureBuffer CompositionParameters
1Cell lysis50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF, DNase ISonication: 6 cycles, 30s on/30s off
2Membrane isolationSame as lysis bufferUltracentrifugation: 100,000 × g, a 1h, 4°C
3Membrane solubilizationLysis buffer + 1% DDMGentle rotation, 2h, 4°C
4Affinity chromatography50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.05% DDMImidazole gradient: 20-500 mM
5Size exclusion chromatography25 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% DDMFlow rate: 0.5 ml/min

After purification, verify protein purity by SDS-PAGE (>95% purity) and assess functionality through appropriate activity assays. For structural studies, additional buffer optimization may be necessary to maintain protein stability while removing excess detergent .

How can researchers validate the function of YcjF in laboratory settings?

Validating YcjF function requires multiple complementary approaches:

  • Genetic Approaches:

    • Generate ycjF knockout strains using CRISPR-Cas9 or λ-Red recombineering

    • Perform genetic complementation studies with wild-type and mutant variants

    • Conduct phenotypic analyses comparing growth rates, stress responses, and morphological changes

  • Biochemical Characterization:

    • Test potential enzymatic activities based on genomic context

    • Considering its genomic proximity to ycjQ and ycjS (dehydrogenases), assess oxidoreductase activity using NAD+/NADH-coupled assays

    • Investigate protein-protein interactions with other membrane components

  • Structural Biology:

    • Perform circular dichroism to assess secondary structure in different detergent environments

    • Consider cryo-EM or X-ray crystallography for detailed structural analysis

  • Functional Assays:

    • Based on the relationship between ycjF and other genes in the ycj cluster, investigate potential roles in carbohydrate metabolism

    • Test substrate specificity using various sugar derivatives similar to those processed by YcjQ (3-keto-D-guloside) and YcjS (3-keto-D-glucoside)

How does YcjF potentially interact with other components of membrane protein insertion pathways?

While YcjF itself has not been directly characterized in membrane protein insertion pathways, insights can be drawn from related membrane proteins like YajC, which plays a significant role in these processes. Analysis of potential YcjF interactions with insertion pathway components would require:

  • Co-immunoprecipitation Studies:

    • Using tagged YcjF to pull down interaction partners

    • Mass spectrometry analysis of co-precipitated proteins

    • Validation of interactions through reverse co-IP experiments

  • Bacterial Two-Hybrid Assays:

    • Screening for interactions with known components of insertion machinery

    • Focus on SecYEG complex components, SRP (Signal Recognition Particle) proteins, and YidC insertases

  • Functional Overlap Investigation:

    • Create double knockout strains (ΔycjF combined with Δsec or ΔyidC components)

    • Assess synthetic phenotypes that might indicate functional overlap

    • Monitor changes in membrane proteome composition using quantitative proteomics

Research on YajC has shown its involvement in the SRP-SecYEG-YajC-YidC1 and SRP-YajC-YidC2 pathways, suggesting potential roles in protein translocation or complex stabilization. YcjF might participate in similar pathways or serve complementary functions in membrane protein biogenesis .

What experimental approaches can resolve contradicting data regarding YcjF function?

When faced with contradicting data regarding YcjF function, implement the following systematic approach:

  • Meta-analysis of Existing Studies:

    • Compile all published data on YcjF and related UPF0283 family proteins

    • Identify methodological differences that might explain discrepant results

    • Create a matrix of experimental conditions versus outcomes to pinpoint variables affecting results

  • Standardized Replication Studies:

    • Design experiments that systematically vary key parameters:

      • Growth conditions (media composition, temperature, oxygen availability)

      • Genetic background (lab strains vs. clinical isolates)

      • Assay methods (in vitro vs. in vivo readouts)

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from ycjF mutants

    • Use computational approaches to identify perturbed pathways across different datasets

    • Develop testable hypotheses based on integrated analysis

  • Collaborative Cross-validation:

    • Establish a consortium approach where multiple labs test identical constructs and strains

    • Implement standardized protocols with pre-registered analysis plans

    • Pool resources for more expensive techniques (e.g., cryo-EM, hydrogen-deuterium exchange mass spectrometry)

By systematically addressing variables and employing complementary techniques, contradictions can be resolved and contribute to a more comprehensive understanding of YcjF function .

How conserved is YcjF across bacterial species and what does this suggest about its function?

YcjF belongs to the UPF0283 family of membrane proteins that shows conservation across various bacterial species, particularly within Enterobacteriaceae. Phylogenetic analysis reveals:

Bacterial GroupYcjF HomologyPredicted Function Conservation
E. coli strains95-100%High - likely identical function
Enterobacteriaceae70-90%Substantial - core function preserved
Other γ-proteobacteria40-65%Moderate - similar but potentially adapted function
Gram-positive bacteria<30%Low - functional divergence likely

This conservation pattern suggests that YcjF serves an important, though not essential, function in bacterial physiology. The higher conservation within Enterobacteriaceae indicates that YcjF may be involved in processes specific to this family, possibly related to membrane organization or metabolic pathways common in these organisms.

Genomic context analysis shows that ycjF is often located in proximity to genes involved in carbohydrate metabolism (like ycjQ and ycjS), suggesting potential involvement in related processes. The co-evolution of these genes further reinforces their functional relationship .

What potential does YcjF have as a therapeutic target based on current understanding?

While direct information on YcjF as a therapeutic target is limited, inference from related membrane proteins suggests several avenues for exploration:

  • Target Validation Criteria:

    • Essentiality: Although not essential under standard laboratory conditions, YcjF may become critical under specific infection-relevant conditions

    • Conservation: Moderate conservation across pathogenic species suggests potential for broad-spectrum approaches

    • Uniqueness: No known human homologs reduces off-target concerns

  • Therapeutic Approaches:

    • Small molecule inhibitors: Target potential membrane-embedded active sites

    • Peptide inhibitors: Design peptides that disrupt protein-protein interactions

    • Antibody-based approaches: For extracellular domains, if present

  • Potential Applications:

    • Biofilm prevention: By analogy to YajC in Enterococcus faecium, YcjF might play roles in biofilm formation

    • Metabolic disruption: Inhibition might compromise bacterial metabolic adaptations

    • Membrane integrity: Targeting could potentially disrupt membrane protein homeostasis

Research on YajC has shown that its deletion resulted in impaired biofilm formation in vitro and attenuated virulence in a rat endocarditis model. If YcjF functions in related pathways, similar therapeutic potential might exist. Additionally, the success of small molecule screening in identifying compounds targeting YidC in Staphylococcus aureus that reduced biofilm formation suggests parallel approaches could be viable for YcjF-targeted therapeutics .

What methodologies are recommended for studying YcjF's role in biofilm formation?

To comprehensively investigate YcjF's potential role in biofilm formation, researchers should employ a systematic approach with these key methodologies:

  • Genetic Manipulation Studies:

    • Generate clean deletion mutants (ΔycjF) using scarless techniques

    • Create complemented strains with wild-type and site-directed mutants

    • Develop inducible expression systems to control timing of YcjF expression

  • Quantitative Biofilm Assays:

    • Crystal violet staining: For total biomass quantification

    • Confocal laser scanning microscopy: For 3D structure analysis

    • Flow cell systems: For dynamic biofilm formation under flow conditions

  • Molecular Composition Analysis:

    • Extracellular polymeric substance (EPS) quantification: Measure polysaccharides and eDNA

    • Proteomics: Compare matrix and cell surface proteins between wild-type and ΔycjF

    • Metabolomics: Identify metabolic shifts associated with biofilm formation

  • Environmental Variation Testing:

    • Assess biofilm formation under various pH, temperature, nutrient conditions

    • Test effects of mechanical stress and antimicrobial challenges

  • In vivo Models:

    • Animal infection models: Such as the rat endocarditis model used for YajC

    • Ex vivo tissue models: Using relevant host tissue surfaces

Data from multiple approaches should be integrated to build a comprehensive model of YcjF's function in biofilm processes. Looking at YajC research as a template, researchers should pay particular attention to surface protein retention, as YajC deletion resulted in impaired attachment of biofilm-associated proteins. Mass spectrometry analysis of supernatants from washed cells could reveal whether YcjF plays a similar role in protein attachment to the cell surface .

What imaging techniques are most suitable for visualizing YcjF localization in bacterial membranes?

Visualizing YcjF localization in bacterial membranes requires specialized techniques that balance resolution with preservation of membrane structure and protein function:

  • Fluorescence Microscopy Approaches:

    • Protein Tagging Strategy:

      • C-terminal or internal fluorescent protein fusion (msfGFP, mCherry)

      • Split-GFP complementation for minimal disruption

      • HaloTag or SNAP-tag for pulse-chase dynamics

    • Super-resolution Techniques:

      • PALM/STORM: 20-30 nm resolution, suitable for single-molecule localization

      • STED microscopy: 30-50 nm resolution, less photobleaching concerns

      • SIM: 100 nm resolution, gentler on living samples

  • Electron Microscopy Methods:

    • Immunogold labeling: Combined with TEM for precise localization

    • Cryo-electron tomography: For native state visualization in 3D

    • CEMOVIS: For high-resolution in vitrified sections

  • Correlative Light and Electron Microscopy (CLEM):

    • Combines fluorescence specificity with EM ultrastructural context

    • Particularly valuable for rare events or specific timepoints

  • Live-cell Imaging Optimizations:

    • Microfluidic devices for controlled environment manipulation

    • Photoactivatable probes for pulse-chase experiments

    • Dual-color imaging to study co-localization with other membrane components

When implementing these techniques, researchers should validate localization patterns using multiple approaches and carefully control for potential artifacts due to protein overexpression or tag interference with membrane integration .

What bioinformatic tools and databases are most useful for studying YcjF and related membrane proteins?

For comprehensive bioinformatic analysis of YcjF and related membrane proteins, researchers should utilize these specialized tools and databases:

CategoryTool/DatabaseApplication for YcjF Research
Sequence AnalysisUniProt (A7ZZR4)Curated annotation and sequence data
BLAST/PSI-BLASTHomology identification across species
HMMERProfile-based homology detection
Structural PredictionTMHMM/TOPCONSTransmembrane topology prediction
AlphaFold/RoseTTAFoldAb initio structure prediction
Phyre2Template-based structure modeling
Functional PredictionInterProDomain and functional site identification
STRINGProtein-protein interaction networks
KEGGMetabolic pathway mapping
Evolutionary AnalysisConSurfEvolutionary conservation mapping
CLANSClustering analysis of protein families
GeneMANIAGene function prediction from networks
Expression DataGEO/ArrayExpressTranscriptomic profiles under various conditions
PaxDbProtein abundance across organisms
Specialized ResourcesTCDBTransporter classification
MicrobesOnlineGenomic context and operon analysis
TransportDBPredicted transporters in complete genomes

For membrane proteins like YcjF, structural prediction tools should be used with caution and validated against experimental data whenever possible. Integration of results from multiple tools provides more reliable predictions than reliance on any single approach .

What are the most promising unresolved questions about YcjF that warrant further investigation?

Several critical aspects of YcjF biology remain unexplored and represent significant opportunities for breakthrough research:

  • Structural Characterization:

    • Determination of high-resolution structure using cryo-EM or X-ray crystallography

    • Elucidation of potential conformational changes during function

    • Identification of functional domains and critical residues

  • Molecular Function:

    • Definitive identification of biochemical activity (transporter, enzyme, scaffold?)

    • Substrate specificity and kinetic parameters

    • Regulatory mechanisms controlling activity

  • System Integration:

    • Comprehensive interactome mapping to identify protein partners

    • Metabolic flux analysis to position YcjF in cellular pathways

    • Regulatory network analysis to understand expression control

  • Physiological Relevance:

    • Contribution to stress responses (pH, antibiotics, oxidative stress)

    • Role in niche adaptation and environmental persistence

    • Impact on virulence or commensalism in host environments

  • Evolutionary Significance:

    • Evolutionary history and selective pressures on YcjF

    • Functional divergence across bacterial lineages

    • Horizontal gene transfer patterns in the ycj cluster

These research questions should be approached using integrative strategies that combine traditional biochemistry and genetics with cutting-edge technologies like CRISPR-based screens, high-resolution imaging, and systems biology approaches .

How might developing technologies advance our understanding of YcjF function in the next decade?

Emerging technologies promise to revolutionize our understanding of membrane proteins like YcjF in the coming decade:

  • Advanced Structural Biology:

    • Cryo-EM advancements: Higher resolution imaging of membrane protein complexes in native-like environments

    • Integrative structural biology: Combining multiple techniques (SAXS, NMR, cryo-EM) with computational modeling

    • Time-resolved structural studies: Capturing conformational changes during function

  • Single-Molecule Technologies:

    • Single-molecule FRET: For studying conformational dynamics in real-time

    • Nanopore recording: For direct measurement of transport activities

    • Optical tweezers: For measuring forces involved in protein-protein or protein-substrate interactions

  • Cellular Imaging Innovations:

    • Lattice light-sheet microscopy: For long-term live imaging with minimal phototoxicity

    • Expansion microscopy: For super-resolution imaging of bacterial structures

    • Correlative cryo-fluorescence and cryo-EM: For precise localization in cellular context

  • Genetic Engineering Breakthroughs:

    • CRISPR interference (CRISPRi): For tunable gene repression

    • Base editing and prime editing: For precise genomic modifications

    • Synthetic genetic circuits: For controlling protein expression with high precision

  • Artificial Intelligence Applications:

    • Deep learning for structure prediction: Beyond AlphaFold to handle membrane protein complexes

    • Machine learning for functional prediction: Based on integrated multi-omics data

    • Network analysis algorithms: For placing YcjF in the context of cellular systems

These technologies will enable researchers to address previously intractable questions about YcjF's function, potentially revealing novel roles in bacterial physiology and pathogenesis that could inform therapeutic strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.