Recombinant Escherichia coli O9:H4 Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; EcHS_A1459; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function

Mediates efflux of zinc ions.

Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ZntB and what is its role in bacterial zinc homeostasis?

ZntB is a membrane transporter protein in Escherichia coli that plays a crucial role in zinc homeostasis. While previously thought to function as a zinc exporter, recent evidence from transport assays and structural studies indicates that ZntB primarily functions as a zinc importer.

Research findings show that ZntB belongs to the CorA superfamily of transporters, though its transport mechanism differs significantly from CorA channels. ZntB mediates Zn²⁺ uptake into bacterial cells, stimulated by a pH gradient across the membrane . This makes ZntB an essential component of the bacterial zinc regulatory network, which maintains proper intracellular zinc concentrations—an element critical for numerous enzymatic and structural functions within the cell.

How is the function of ZntB experimentally determined in E. coli?

The function of ZntB has been investigated through multiple complementary approaches:

  • Isothermal Titration Calorimetry (ITC): Measures the binding affinity and thermodynamics of zinc interaction with ZntB .

  • Radio-ligand uptake assays: Uses ⁶⁵Zn²⁺ to quantitatively track zinc transport across membranes in ZntB-reconstituted liposomes .

  • Fluorescent transport assays: Employs fluorescent probes to monitor real-time zinc transport .

  • Growth assays in zinc-limited media: Demonstrates the importance of ZntB by comparing wild-type and mutant strains in zinc-deficient conditions. These assays revealed that introduction of znuACB (encoding the ZnuACB transporter) or zupT (encoding ZupT) into zinc transporter-deficient E. coli strains restored growth in zinc-limited media .

Transport SystemEffect on Growth in Zinc-Limited Media⁶⁵Zn²⁺ Uptake
Wild-typeNormal growthNormal
ΔznuACBModerately impairedIntermediate reduction
ΔzupTNear normalSlight reduction
ΔznuACB ΔzupTSeverely impairedMajor reduction
+znuACB complementationRestored growthRestored uptake

How does ZntB's structure relate to its function in E. coli?

The structure-function relationship of ZntB has been revealed through cryo-electron microscopy studies of the full-length ZntB protein from E. coli . Key structural findings include:

  • ZntB forms a symmetrical pentamer that spans the bacterial membrane

  • Unlike CorA channels, ZntB maintains its symmetrical pentameric conformation even after extensive treatment with EDTA (to remove divalent cations)

  • The cytoplasmic domain of full-length EcZntB has a strong positive electrostatic surface potential, contrasting with the negative potential observed in isolated domains of ZntB from other species

Structural analysis revealed that ZntB likely undergoes conformational changes during the transport cycle, with helical rotations of transmembrane segments creating a pathway for zinc ions. The shape of the internal pore differs between conformational states, which may represent different stages in the transport cycle .

What techniques are used to produce recombinant ZntB for structural and functional studies?

Researchers employ several approaches for recombinant ZntB expression:

  • Expression system selection: The T7 promoter-based pET expression system is widely used for ZntB expression in E. coli due to its strong, inducible nature. This system allows recombinant protein accumulation of up to 50% of total cellular proteins .

  • Optimization of expression conditions:

    • Promoter selection: T7 promoter provides strong expression with minimal basal activity

    • Codon optimization: Particularly important for the first 16-18 codons to prevent mRNA secondary structures

    • N-terminal tag selection: Fusion tags enhance solubility and facilitate purification

  • Membrane protein-specific strategies:

    • Prevention of toxicity through controlled expression rates

    • Co-expression of chaperones and biogenesis factors

    • Use of specialized E. coli strains designed for membrane protein expression

For successful ZntB purification, researchers typically employ affinity chromatography followed by size exclusion chromatography in detergent micelles or lipid nanodiscs to maintain native conformation.

What is the debate regarding ZntB's function as a zinc importer versus exporter?

The functional classification of ZntB has been a subject of scientific debate:

Arguments for export function:

  • Early whole-cell transport assays suggested ZntB functioned as a Zn²⁺ and Cd²⁺ exporter

  • Its structural similarity to CorA channels initially led to assumptions about similar function

Arguments for import function:

  • Recent evidence from regulatory studies in C. metallidurans showed ZntB is downregulated in high zinc conditions—consistent with an import function

  • Direct transport assays using reconstituted liposomes demonstrated ZntB mediates zinc uptake

  • ZntB's transport is stimulated by a pH gradient, supporting a proton-coupled import mechanism

Current consensus based on direct transport assays favors ZntB functioning primarily as a proton-driven zinc importer .

What is the mechanism of proton-driven zinc transport by ZntB?

The transport mechanism of ZntB involves proton coupling and differs significantly from that of CorA magnesium channels. Key aspects include:

  • Proton gradient dependency: ZntB-mediated Zn²⁺ uptake is stimulated by a pH gradient across the membrane, indicating a proton-coupled transport mechanism .

  • Zn²⁺/H⁺ co-transport: Evidence suggests ZntB functions as a Zn²⁺/H⁺ co-transporter rather than a simple channel .

  • Conformational states: Unlike CorA channels that collapse into highly asymmetrical states upon divalent cation depletion, ZntB maintains a symmetrical pentameric state . This indicates a different gating mechanism.

  • Charge inversion mechanism: The transport cycle likely involves helical rotations of transmembrane segments, particularly TM1, which contains conserved basic and acidic residues on adjacent faces. This rotation changes the electrostatic profile of the transport pathway .

  • Surface potential changes: Dramatic differences in surface electrostatic potential between different conformational states suggest an electrostatic mechanism for zinc transport .

This proton-driven mechanism aligns with broader bacterial strategies for maintaining proton motive force (PMF) and membrane potential as described in research on E. coli pH homeostasis .

How does ZntB differ from other zinc transporters in E. coli?

E. coli employs multiple zinc transporters with distinct properties:

TransporterFamilyTransport DirectionEnergy SourceAffinitySpecificity
ZntBCorA superfamilyImportProton gradientMediumZinc-specific
ZnuACBABC transporter familyImportATP hydrolysisHighZinc-specific
ZupTZIP familyImportChemo-osmotic gradientLow-MediumBroader (also Mn²⁺, Fe²⁺)
SitABCDABC transporter familyPrimarily Mn/Fe, limited ZnATP hydrolysisLow (for Zn)Broad

Key differences include:

  • Transport mechanism: While ZnuACB uses ATP hydrolysis, ZntB employs proton coupling, and ZupT relies on a chemiosmotic gradient .

  • Affinity and specificity: ZnuACB demonstrates the highest zinc affinity, featuring a periplasmic ligand-binding protein (ZnuA) with a metal-binding histidine-rich loop and a high-affinity zinc-binding pocket. ZntB has moderate affinity, while ZupT shows broader specificity .

  • Relative contribution: Growth and uptake studies demonstrate that ZnuACB is the predominant zinc transporter, followed by ZntB, with ZupT having a smaller contribution. In a ΔznuACB background, additional deletion of zupT or sitABCD did not further reduce ⁶⁵Zn²⁺ uptake .

  • Physiological role: Growth studies suggest these transporters have complementary but partially redundant functions in zinc homeostasis .

What key residues are involved in the zinc transport pathway through ZntB?

The zinc transport pathway through ZntB involves several critical amino acid residues that have been identified through structural studies and site-directed mutagenesis:

  • Transmembrane channel residues: The transport pathway is lined with conserved charged and polar residues that facilitate zinc movement .

  • TM1 charged residues: TM1 contains a patch of highly conserved basic and acidic residues on adjacent faces. The helical rotation of TM1 is thought to change the charge characteristics of the pore during transport .

  • Metal-binding sites: Specific coordination sites for zinc have been identified within the pore, typically involving histidine, glutamate, aspartate, and cysteine residues that provide appropriate coordination geometry for zinc ions .

  • Gating residues: Conserved residues at the entrance and exit of the pore likely function as gates controlling zinc passage .

Site-directed mutagenesis of these key residues significantly affects transport function, confirming their importance in the mechanism. The full transport pathway involves coordinated interactions with these residues as the zinc ion traverses the membrane .

How does the proton motive force affect ZntB function?

Research demonstrates that the proton motive force (PMF) is critical for ZntB function:

  • Direct coupling: ZntB-mediated zinc transport is stimulated by a pH gradient across the membrane, indicating direct coupling between proton movement and zinc transport .

  • PMF components: The PMF consists of two components:

    • ΔpH (pH gradient across the membrane)

    • Δψ (electrical potential across the membrane)

    ZntB primarily utilizes the ΔpH component to drive zinc uptake .

  • Experimental evidence: Studies measuring membrane potential and cytoplasmic pH in single cells demonstrate that decreasing PMF strength impairs E. coli's ability to maintain pH homeostasis, which directly affects zinc transport systems including ZntB .

  • Model prediction: Mathematical modeling suggests that near neutral pH homeostasis implies that cells must export ions other than protons to generate physiological electrical potential across their plasma membrane. For E. coli, proton:ion antiporters (conceptually similar to ZntB's mechanism) are critical for maintaining membrane potential .

  • PMF collapse effects: Artificial collapse of the PMF destroys the out-of-equilibrium plasma membrane potential, directly impacting transport systems like ZntB that rely on this gradient .

How does ZntB contribute to bacterial virulence and pathogenesis?

Zinc transporters including ZntB can influence bacterial virulence through several mechanisms:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.