Recombinant Escherichia coli O9:H4 Zinc transporter ZupT (zupT)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

ZupT (encoded by the zupT gene, formerly ygiE) is a cytoplasmic membrane protein with 328 amino acids. It is the first bacterial member of the ZIP family, which includes eukaryotic metal transporters like Arabidopsis ZIP1 and human hZIP1 . Key features include:

  • Topology: Predicted eight transmembrane domains

  • Metal specificity: Broad substrate range (Zn²⁺, Fe²⁺, Co²⁺, Mn²⁺)

  • Mechanism: Proton-coupled symport or uniport, independent of ATP

Substrate Specificity and Transport Efficiency

ZupT exhibits low-affinity but broad-spectrum metal transport:

Metal IonRelative Uptake EfficiencyCompetitive Inhibition Observed
Zn²⁺Primary substrate
Fe²⁺40-60% of Zn²⁺ efficiencyInhibited by Zn²⁺, Mn²⁺
Co²⁺30-50% of Zn²⁺ efficiencyInhibited by Zn²⁺
Mn²⁺<20% of Zn²⁺ efficiencyInhibited by Zn²⁺, Fe²⁺

Data from isotopic tracer studies (⁵⁵Fe, ⁵⁷Co, ⁶⁵Zn) in E. coli K-12 and UPEC strains .

Genetic Regulation

Unlike the inducible ZnuABC system, ZupT operates under constitutive expression:

  • Promoter activity: Φ(zupT-lacZ) fusions show constant β-galactosidase production regardless of extracellular zinc (0–100 µM)

  • Regulatory mutants: No identified Zur (zinc uptake regulator) binding sites upstream of zupT

Functional Redundancy with ZnuABC

ZupT and ZnuABC provide complementary zinc acquisition pathways:

PropertyZupTZnuABC
Transport mechanismChemiosmotic gradientATP-dependent ABC transporter
Zn²⁺ affinityLow (Km ~10 µM)High (Km ~0.1 µM)
Dominance in UPECSecondaryPrimary
⁶⁵Zn²⁺ uptake rate12.3 ± 1.7 nmol/min/mg protein34.8 ± 2.9 nmol/min/mg protein

In uropathogenic E. coli (UPEC) CFT073, ZnuABC accounts for ~70% of total zinc uptake under zinc-limited conditions .

5.1. Virulence in Urinary Tract Infections

  • Mouse model data:

    • ΔzupT mutants show no fitness defect in bladder/kidney colonization

    • Δznu mutants exhibit 4.4-fold (bladder) and 41-fold (kidney) reductions vs wild-type

    • Double ΔznuΔzupT mutants show additive effects (30-fold bladder, 48-fold kidney reductions)

5.2. Stress Resistance

  • Hydrogen peroxide sensitivity:

    • ΔznuΔzupT strains show 3.2-log reduction in survival vs wild-type after 1 mM H₂O₂ exposure

  • Motility impairment:

    • Zinc-deficient ΔznuΔzupT mutants exhibit 65% reduced swarming motility

6.1. Metal Rescue Assays

  • EDTA sensitivity:

    • E. coli GR352 (ΔznuABC) requires ≥10 µM Zn²⁺ for growth in LB + 0.5 mM EDTA

    • ΔzupT mutants tolerate 1.2 mM EDTA without zinc supplementation

6.2. Heterologous Expression

  • Arabidopsis ZIP1: Rescues iron uptake in E. coli ΔfepA ΔfeoABC ΔmntH mutants

  • ZupT overexpression: Causes Zn²⁺ hypersensitivity (EC₅₀ = 15 µM Zn²⁺ in ΔzntAΔzitB strains)

Biotechnological Applications

While not yet commercially exploited, ZupT’s properties suggest potential uses in:

  1. Bioremediation: Broad-spectrum metal uptake for environmental detoxification

  2. Synthetic biology: Modular metal acquisition module for engineered bacteria

  3. Antimicrobial targets: Disrupting zinc homeostasis in multidrug-resistant UPEC strains

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize development of the specified tag.
Synonyms
zupT; EcHS_A3217; Zinc transporter ZupT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Escherichia coli O9:H4 (strain HS)
Target Names
zupT
Target Protein Sequence
MSVPLILTILAGAATFIGAFLGVLGQKPSNRLLAFSLGFAAGIMLLISLMEMLPAALAAE GMSPVLGYGMFIFGLLGYFGLDRMLPHAHPQDLMQKSVQPLPKSIKRTAILLTLGISLHN FPEGIATFVTASSNLELGFGIALAVALHNIPEGLAVAGPVYAATGSKRTAILWAGISGLA EILGGVLAWLILGSMISPVVMAAIMAAVAGIMVALSVDELMPLAKEIDPNNNPSYGVLCG MSVMGFSLVLLQTAGIG
Uniprot No.

Target Background

Function
Mediates zinc uptake. May also transport other divalent cations.
Database Links
Protein Families
ZIP transporter (TC 2.A.5) family, ZupT subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of ZupT in Escherichia coli?

ZupT (previously known as ygiE) functions as a zinc uptake system in Escherichia coli. It was experimentally determined to mediate zinc transport across the bacterial membrane, enabling cells to acquire this essential micronutrient from the environment. Growth experiments with cells disrupted in both zupT and the znuABC operon demonstrated severe inhibition by EDTA at much lower concentrations compared to single mutants or wild-type strains, confirming the zinc transport role .

Functionally, ZupT appears to have a lower affinity for zinc than the ZnuABC system, as strains with a deletion of zupT show less growth inhibition by high EDTA concentrations than strains with znuABC deletions . Experimental evidence supporting this function includes:

  • Growth inhibition studies with EDTA

  • Complementation of growth inhibition with zinc supplementation

  • Direct measurement of increased 65Zn2+ uptake in cells expressing ZupT from a plasmid

How does ZupT differ from other zinc transporters in E. coli?

ZupT represents one of multiple zinc transport systems in E. coli, with distinct characteristics compared to the primary high-affinity zinc transporter ZnuABC. The key differences are:

FeatureZupTZnuABC
FamilyZIP (Zrt-, Irt-like Protein)ABC transporter family
Affinity for zincLower affinityHigher affinity
Metal specificityPotentially broader range (may transport Cd(II) and Cu(II))More specific for zinc
Contribution to growth in zinc-limited conditionsSecondary importancePrimary transporter
Impact on virulence in UTI modelsMinimal when deleted aloneSignificant attenuation when deleted

How can ZupT expression be manipulated for research purposes?

To manipulate ZupT expression for experimental studies, researchers have employed several methodologies:

  • Gene deletion approach: Creating ΔzupT mutant strains using targeted gene disruption techniques. This has been accomplished using methods described previously for precise gene deletion as mentioned in the literature .

  • Plasmid-based overexpression: Using expression vectors with inducible promoters, such as those regulated by anhydrotetracycline (AHT). Researchers have successfully expressed zupT from plasmids, inducing expression with 200 ng/ml of AHT, which led to measurable changes in zinc uptake .

  • Combination with other mutations: Creating double or multiple mutants (e.g., ΔznuABC ΔzupT) to investigate the combined effects of zinc transport system disruptions .

For optimal results when manipulating ZupT expression, researchers should consider:

  • The growth medium's zinc content

  • Possible addition of chelators like EDTA to create zinc-limited conditions

  • Potential toxicity when overexpressing ZupT in strains lacking efficient zinc efflux systems (e.g., ΔzntA ΔzitB)

How do ZupT and ZnuABC systems interact during zinc limitation and infection?

The interaction between ZupT and ZnuABC represents a hierarchical system for zinc acquisition in E. coli, particularly during infection scenarios. Research has revealed several key aspects of their functional relationship:

  • Complementary but unequal roles: ZnuABC functions as the primary high-affinity zinc transporter, while ZupT serves as a secondary system with lower apparent affinity. This was demonstrated through 65Zn2+ uptake experiments showing that CFT073ΔzupT mutants exhibited less marked decreases in zinc uptake compared to CFT073Δznu mutants .

  • Cumulative effects during infection: During urinary tract infection experiments in CBA/J mice, the loss of both systems produced more severe attenuation than either single mutation:

    • ΔzupT alone: No significant disadvantage

    • Δznu alone: 4.4-fold reduction in bladders, 41-fold reduction in kidneys

    • Δznu ΔzupT double mutant: 30-fold reduction in bladders, 48-fold reduction in kidneys

  • Environmental dependencies: The relative importance of each system varies based on the zinc concentration in the environment. In zinc-replete conditions like human urine, neither system appears essential for growth in vitro, whereas both contribute to fitness during in vivo infection .

The data suggest a model where ZnuABC serves as the specialized high-affinity zinc acquisition system essential during severe zinc limitation (as encountered during host infection), while ZupT provides supplementary zinc uptake capacity that becomes significant primarily when ZnuABC is absent or overwhelmed.

What experimental approaches can be used to measure ZupT-mediated zinc transport?

Several methodological approaches have been validated for measuring ZupT-mediated zinc transport, each with specific advantages:

  • Radioactive 65Zn2+ uptake assays: This direct measurement approach provides quantitative data on zinc transport rates. For optimal results, researchers should:

    • Create strains with disruptions in other zinc transport systems to isolate ZupT function

    • Include appropriate controls (vector-only strains)

    • Use controlled induction of ZupT expression (e.g., with anhydrotetracycline)

  • Growth inhibition/rescue experiments: This indirect approach measures the functional consequences of ZupT activity:

    • Grow cells in minimal medium with zinc chelators (EDTA)

    • Measure growth with/without zinc supplementation

    • Compare growth between wild-type, ΔzupT, and complemented strains

  • Metal sensitivity assays: Leveraging ZupT's potential role in transporting other metals:

    • Express ZupT in strains lacking zinc efflux systems (ΔzntA ΔzitB)

    • Measure sensitivity to various metals (zinc, cadmium, copper)

    • Quantify growth inhibition zones or minimal inhibitory concentrations

Example experimental setup for 65Zn2+ uptake assay:

ComponentSpecification
Bacterial strainE. coli with deletions in znuABC, zntA, zitB, and zntB
Expression vectorpZUPT (inducible) or empty vector control
InducerAnhydrotetracycline (0-200 ng/ml)
Radioisotope65Zn2+ at defined concentration
Incubation time10 minutes post-induction
MeasurementScintillation counting after washing cells

This assay system enabled researchers to demonstrate that cells with the largest amount of inducer (200 ng/ml) showed the greatest increase in zinc uptake compared to vector controls .

How does ZupT contribute to bacterial pathogenesis during urinary tract infection?

ZupT's contribution to pathogenesis during urinary tract infection (UTI) appears to be secondary but complementary to the ZnuABC system. Research using UTI models has revealed several insights:

  • Independent vs. competitive infections:

    • In competitive infections with wild-type strains, the ΔzupT single mutant showed no significant disadvantage

    • The Δznu mutant showed significant attenuation (4.4-fold reduction in bladders, 44-fold in kidneys)

    • The Δznu ΔzupT double mutant exhibited more severe attenuation (30-fold reduction in bladders, 48-fold in kidneys)

  • Single-strain infection outcomes:

    • Both Δznu and Δznu ΔzupT mutants showed significant reductions in kidney colonization

    • Bladder colonization levels were similar to wild-type in single-strain infections

  • Mechanisms underlying virulence contribution:

    • ZupT's role in pathogenesis appears linked to specific virulence factors rather than simple growth

    • Mutants lacking zinc transport systems showed decreased motility

    • Reduced resistance to hydrogen peroxide was observed, suggesting impaired defense against oxidative stress

    • Both phenotypes were restored by zinc supplementation

This data suggests that while ZupT alone is not critical for UTI virulence, it provides a supplementary zinc acquisition mechanism that becomes significant when the primary ZnuABC system is absent. The combined loss of both systems has a cumulative negative effect on bacterial fitness during infection, potentially through impairment of zinc-dependent processes important for motility and oxidative stress resistance.

What is known about the metal specificity of ZupT compared to other bacterial zinc transporters?

ZupT demonstrates broader metal specificity compared to the more zinc-specific ZnuABC system, a characteristic that may be important for its physiological role:

While the ZnuABC system appears to have evolved as a specialized high-affinity zinc acquisition system, ZupT's broader specificity suggests it may serve as a more general divalent cation transporter that primarily handles zinc but can also process other metals when present at sufficient concentrations.

What controls should be included when studying ZupT function in recombinant systems?

When designing experiments to study ZupT function in recombinant systems, several critical controls should be incorporated to ensure valid and interpretable results:

  • Empty vector controls:

    • Essential for plasmid-based expression studies

    • Controls for effects of the expression system itself

    • Provides baseline for measuring ZupT-specific effects

  • Genetic background controls:

    • Wild-type parent strain

    • Single mutants (ΔzupT alone, Δznu alone)

    • Strains with deletions in other metal transport systems depending on the specific question

    • Complemented mutant strains to confirm phenotype restoration

  • Metal specificity controls:

    • Include tests with multiple metals (Zn, Cu, Cd, Ni) to determine specificity

    • Use metal chelators of varying affinities (EDTA, specific zinc chelators)

    • Include zinc supplementation conditions to demonstrate rescue effects

  • Expression level controls:

    • Titrate inducer concentrations to control expression levels

    • Monitor expression using reporter constructs or direct protein measurement

    • Consider toxicity controls, especially in strains lacking metal efflux systems

Example control matrix for zinc uptake experiments:

Strain BackgroundPlasmidInducer ConcentrationChelatorMetal Supplementation
Wild-typeEmpty vector0 ng/mlNoneNone
Wild-typepZUPT0, 50, 100, 200 ng/mlNoneNone
ΔzupTEmpty vector0 ng/mlNoneNone
ΔzupTpZUPT0, 50, 100, 200 ng/mlNoneNone
Δznu ΔzupTEmpty vector0 ng/mlNoneNone
Δznu ΔzupTpZUPT0, 50, 100, 200 ng/mlNoneNone
Δznu ΔzupTpZUPT200 ng/mlEDTA (varying)Zn, Cu, Cd, Ni

This comprehensive control strategy helps distinguish ZupT-specific effects from background effects and enables accurate characterization of transporter function and specificity.

How can researchers address data contradictions in zinc transport studies involving ZupT?

Researchers investigating ZupT function may encounter apparent contradictions in experimental data. Several methodological approaches can help resolve these discrepancies:

  • Strain-specific differences:

    • Different E. coli strains may show varying dependence on zinc transporters

    • Laboratory strains (K-12) versus pathogenic strains (UPEC CFT073) may exhibit different phenotypes

    • Systematically test multiple strains under identical conditions to identify strain-specific effects

  • Growth condition variables:

    • Zinc availability dramatically affects outcomes (defined minimal media vs. complex media)

    • Temperature, pH, and growth phase can influence transporter expression and function

    • Standardize conditions and include environmental variables as experimental factors

  • Quantitative vs. qualitative assessments:

    • Direct 65Zn2+ uptake measurements may show subtle effects missed in growth-based assays

    • Competitive fitness assays may reveal defects not apparent in single-strain experiments

    • Use multiple complementary methods to evaluate the same phenotype

  • Genetic compensation mechanisms:

    • Other uncharacterized zinc transporters may compensate for zupT deletion

    • Upregulation of alternative pathways may occur in response to zinc limitation

    • Consider using transcriptomics or proteomics to identify compensatory responses

When addressing contradictory data, a systematic approach to reconciliation might include:

  • Re-examining the genetic constructs for unintended mutations

  • Testing whether phenotypes are restored by complementation

  • Determining whether contradictions are quantitative (degree of effect) or qualitative (presence/absence of effect)

  • Evaluating whether differences in experimental conditions explain the contradictions

  • Considering strain-specific genomic differences that might influence results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.