Recombinant Escherichia coli Osmolarity sensor protein EnvZ (envZ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary by purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid form has a 6-month shelf life at -20°C/-80°C, while lyophilized form has a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
envZ; ompB; perA; tpo; b3404; JW3367; Sensor histidine kinase EnvZ; Osmolarity sensor protein EnvZ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-450
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
envZ
Target Protein Sequence
MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTD KLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPT EVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIR IQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAG VSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMAD LNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSS GTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGML ELGTSERGGLSIRAWLPVPVTRAQGTTKEG
Uniprot No.

Target Background

Function
EnvZ is a transmembrane histidine kinase, a component of the EnvZ/OmpR two-component regulatory system crucial for osmoregulation in *Escherichia coli*. It specifically regulates genes such as *ompF* and *ompC*, encoding outer membrane porins. EnvZ responds to environmental osmolarity changes; low osmolarity leads to OmpR-mediated activation of *ompF* transcription, while high osmolarity represses *ompF* and activates *ompC*. EnvZ phosphorylates and dephosphorylates OmpR. Its cytoplasmic dimerization domain exhibits osmosensitivity, influencing its autophosphorylation rate and subsequent signaling. Lipid environment enhances autophosphorylation, highlighting lipid-mediated allosteric regulation of EnvZ kinase activity. EnvZ also plays a role in the acid stress response, independent of OmpR phosphorylation, suggesting additional cytoplasmic pH sensing capabilities.
Gene References Into Functions
  1. Polyphosphate-dependent stalling has minimal impact on EnvZ levels, indicating a primary role for polyP motifs in protein-protein interactions. PMID: 29953503
  2. Analysis of single-cysteine EnvZ variants revealed a key transmembrane domain 1 (TM1) interface involved in signal output regulation. Cys substitutions impacted signal transduction. Osmolarity did not alter TM1 interactions. PMID: 27155567
  3. Cytoplasmic sensing mechanisms of the inner membrane histidine kinase EnvZ. PMID: 25937465
  4. Structural studies reveal an asymmetric histidine kinase dimer, capturing one subunit during autophosphorylation. PMID: 24500224
  5. EnvZ P41L mutations in *E. coli* MG1655 and Nissle 1917 strains resulted in increased OmpR phosphorylation compared to their parental strains. PMID: 24478082
  6. Hydrogen-deuterium exchange mass spectrometry (HDXMS) data indicated that the EnvZ cytoplasmic domain adopts multiple conformations, and osmolytes promoted increased helicity, with high osmolality enhancing His243 autophosphorylation. PMID: 22543870
  7. A significant percentage (10-20%) of motile *E. coli* MG1655 possess EnvZ missense mutations, exhibiting enhanced colonization capabilities in the mouse intestine. PMID: 22392928
  8. In vitro studies demonstrated specific homodimer formation by the cytoplasmic domains of EnvZ and related proteins. PMID: 21854787
  9. MzrA binding to EnvZ influences its responsiveness to periplasmic signals and subsequent output to OmpR. PMID: 20889743
  10. PerA is essential for activation of the LEE1 operon, primarily through autoactivation of the per promoter to ensure sufficient PerC for LEE1 activation. PMID: 15522091
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of EnvZ in Escherichia coli?

EnvZ is a membrane-located osmotic sensor (or signal transducer) in Escherichia coli that plays a crucial role in the regulation of outer membrane proteins OmpF and OmpC in response to changes in medium osmolarity. Structurally, EnvZ contains two transmembrane segments (TM1 and TM2) that span the inner membrane, a periplasmic domain, and a cytoplasmic domain. The protein exhibits dual enzymatic capabilities, functioning with both kinase and phosphatase activities specific for the OmpR response regulator protein . As a homodimeric sensor histidine kinase, EnvZ forms an antiparallel four-helix bundle within its transmembrane domain, which is critical for signal transduction across the membrane .

How does EnvZ sense changes in osmolarity?

EnvZ senses changes in osmolarity through its transmembrane domain (TMD), which is responsible for the allosteric coupling of sensory input from environmental stimuli. Recent research indicates that the ability of the TMD to facilitate transmembrane water molecules plays a significant role in this sensing mechanism. The protein contains water encapsulation motifs composed of two sets of Ser 26, Thr 30, and Thr 164 residues that form pockets within the four-helix bundle of the TMD . These hydrophilic residues create channels that allow water molecules to move across the membrane, and this movement correlates with EnvZ signal output. Changes in membrane tension or hydration resulting from osmotic shifts alter the configuration of these water channels, thereby modulating EnvZ activity .

What is the EnvZ/OmpR two-component system and why is it important?

The EnvZ/OmpR two-component system (TCS) is a critical regulatory mechanism in E. coli that controls the expression of porins on the outer membrane. This system consists of the sensor histidine kinase EnvZ and its cognate response regulator OmpR. When activated by changes in osmolarity, EnvZ autophosphorylates and subsequently transfers the phosphoryl group to OmpR. Phosphorylated OmpR then regulates the differential expression of OmpF and OmpC porins, which are involved in nutrient uptake and osmotic balance . This system is important because it enables bacteria to adapt to changing environmental conditions, particularly variations in osmotic pressure, which is crucial for bacterial survival and pathogenicity.

What are the optimal methods for expressing and purifying recombinant EnvZ protein?

For optimal expression and purification of recombinant EnvZ, researchers typically employ the following methodological approach:

  • Vector Selection: Use expression vectors like pET systems with T7 promoters for high-level expression in E. coli. For membrane proteins like EnvZ, vectors containing fusion tags (His6, MBP, or GST) facilitate purification and can enhance solubility.

  • Expression Conditions: Transform expression vectors into E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3), or BL21(DE3)pLysS). Culture cells at lower temperatures (16-25°C) after induction with reduced IPTG concentrations (0.1-0.5 mM) to minimize inclusion body formation.

  • Membrane Fraction Isolation: Harvest cells and disrupt by sonication or French press in buffer containing protease inhibitors. Separate membrane fractions by ultracentrifugation (100,000 × g for 1 hour).

  • Solubilization: Solubilize membrane fractions using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucopyranoside (OG) at concentrations slightly above their critical micelle concentration.

  • Affinity Purification: Purify using affinity chromatography (Ni-NTA for His-tagged proteins), followed by size-exclusion chromatography to enhance purity.

When working with just the cytoplasmic or periplasmic domains, expression as soluble proteins without the transmembrane regions can significantly improve yields and simplify purification procedures .

How can I assess EnvZ signal output in vivo?

To assess EnvZ signal output in vivo, researchers can employ several approaches:

  • Transcriptional Reporter Systems: Using fluorescent protein reporters like CFP and YFP fused to the promoters regulated by OmpR (such as ompF and ompC promoters). The CFP/YFP fluorescence ratio provides a quantitative measure of steady-state EnvZ signal output . For example, the EPB30/pRD400 cell system allows measurement of CFP fluorescence, YFP fluorescence, and calculation of the CFP/YFP ratio.

  • Growth in Different Osmolarity Regimes: Culture cells expressing wild-type or mutant EnvZ under low- and high-osmolarity conditions to observe differential responses. A shift toward the kinase-dominant state ("on") under low osmolarity results in increased CFP fluorescence, reduced YFP fluorescence, and an increased CFP/YFP ratio, while a shift toward the phosphatase-dominant state ("off") shows the opposite pattern .

  • Protein Expression Analysis: Western blotting can confirm the stable expression of EnvZ variants under different growth conditions, which is essential for proper interpretation of signal output data .

This systematic approach allows for quantitative assessment of EnvZ signaling activity and the impact of specific mutations or environmental conditions on its function.

What techniques are available for studying the transmembrane domains of EnvZ?

Several sophisticated techniques can be employed to study the transmembrane domains of EnvZ:

  • Disulfide Crosslinking Analysis: Create single-cysteine variants throughout the transmembrane regions and analyze disulfide bond formation patterns. This approach has been successfully used to map the TM1-TM1' and TM2-TM2' interfaces in the EnvZ homodimer and to detect conformational changes upon stimulus perception .

  • Molecular Dynamics Simulations: Using structural prediction tools like AlphaFold-Multimer followed by membrane simulation systems (such as EnvZ₂/G-IM) to model the behavior of the transmembrane domain in a lipid bilayer environment. This approach has been validated by comparing inter-residue distances from simulations with experimental crosslinking data .

  • Site-Directed Mutagenesis: Systematic substitution of residues within the transmembrane helices to identify positions critical for signal transduction. For example, cysteine-scanning mutagenesis has revealed that substitutions at certain positions (e.g., 156, 162, 163) significantly elevate signal output, while others reduce it .

  • Structural Analysis: Techniques such as NMR spectroscopy can be used to characterize specific domains of EnvZ, as demonstrated in studies of the periplasmic C-terminal core domain .

A comprehensive approach combining these methods provides valuable insights into the structure-function relationships of EnvZ's transmembrane domains and their role in osmosensing.

How do specific mutations in the transmembrane domains affect EnvZ function?

Specific mutations in the transmembrane domains of EnvZ can significantly alter its function, with effects dependent on the position and nature of the substitution:

  • TM1 Mutations: Amino acid changes in TM1, such as Pro-41 to Ser or Leu, can selectively impair phosphatase activity while maintaining kinase activity, resulting in an OmpF-/OmpC-constitutive phenotype . This suggests that TM1 plays a crucial role in regulating the balance between kinase and phosphatase activities.

  • TM2 Mutations: Cysteine substitutions at the N- and C-terminal regions of TM2 (positions 156, 162, and 163) can elevate signal output by over 5-fold under low-osmolarity conditions. In contrast, substitutions at cytoplasmic positions 181, 182, and 184 increase signal output by over 2-fold .

  • Core TM2 Residues: Between positions 165 and 180 in TM2, a pattern of alternating increases and decreases in signal output is observed with cysteine substitutions, suggesting a helical arrangement where residues facing the same direction have similar effects .

  • High-Osmolarity Responses: When cells are grown under high-osmolarity conditions, many cysteine substitutions in TM2 significantly decrease signal output, with nearly half of the 29 mutants analyzed supporting less than 75% of wild-type signal output .

These findings demonstrate that specific residues within the transmembrane domains are critical for proper EnvZ function, with their roles likely related to their positions within the four-helix bundle and their contributions to water encapsulation motifs and conformational changes during signaling.

What is the role of the periplasmic domain in EnvZ function and homodimerization?

The periplasmic domain of EnvZ (approximately spanning residues Ala38 to Arg162) plays critical roles in both function and homodimerization:

Biochemical and biophysical characterization of this domain has revealed its importance in maintaining the functional architecture of EnvZ, highlighting its role beyond being a simple structural linker between the transmembrane segments.

What is the significance of the water encapsulation motif in EnvZ signaling?

The water encapsulation motif in EnvZ plays a crucial role in its signaling mechanism:

  • Composition: This motif consists of two sets of Ser 26, Thr 30, and Thr 164 residues positioned within the four-helix bundle of the transmembrane domain .

  • Functional Significance: Recent research suggests that EnvZ signal output correlates with the capacity for transmembrane water passage through this motif. The hydrophilic residues create pockets that can accommodate water molecules within the otherwise hydrophobic membrane environment .

  • Signal Modulation: Changes in osmolarity likely affect the hydration state or conformation of these water encapsulation pockets, which in turn alters the conformation of the cytoplasmic domains and modulates the balance between kinase and phosphatase activities.

  • Mutational Effects: Cysteine substitutions that would expand the water encapsulation pockets (e.g., at positions 23 in TM1 or 167 and 168 in TM2) significantly increase EnvZ signal output. These positions face toward the bundle core but are one helical turn lower than the water encapsulation motif residues .

  • Entry Points: Cysteine substitutions at positions 162 and 163, which face outward from the bundle, also activate EnvZ, possibly by facilitating water entry into the encapsulation motifs .

This water-mediated signaling mechanism represents an elegant solution for transmembrane communication in response to osmotic changes, providing insights into how membrane proteins can transduce environmental signals across lipid bilayers.

How does MzrA modulate EnvZ/OmpR signaling, and what regions are essential for this interaction?

MzrA (modulator of EnvZ/OmpR regulon A) is a small membrane protein that modulates EnvZ/OmpR signaling through direct protein-protein interactions:

  • Interaction Mechanism: MzrA directly interacts with EnvZ, affecting its signal output and consequently altering the phosphorylation state of OmpR. This modulation impacts the expression of OmpF and OmpC porins in response to osmotic changes .

  • Essential Regions in MzrA: Analysis of single-cysteine-containing variants of MzrA has identified several regions critical for its interaction with EnvZ:

    • Residues essential for MzrA-EnvZ interactions are located primarily within specific interfaces of the protein .

    • The hydrophobic core of MzrA is critical for maintaining proper protein folding and stability, which is necessary for effective EnvZ modulation .

    • The terminal helix of MzrA contains residues that contribute to EnvZ signal output .

  • Mapping Studies: Research has mapped regions essential for MzrA-induced EnvZ signal output, revealing specific contact points between the two proteins. For example, contact map analysis has identified specific interacting residue pairs between EnvZ and MzrA .

  • Evolutionary Conservation: Sequence alignment of MzrA from twelve bacterial species shows conservation of key residues involved in EnvZ interaction, suggesting the importance of this modulatory mechanism across different bacteria .

This interaction represents an additional layer of regulation in the EnvZ/OmpR system, allowing for fine-tuning of osmotic responses and potentially integrating other environmental signals into the osmosensing pathway.

What computational methods are most effective for studying EnvZ structure and dynamics?

Several computational methods have proven effective for studying EnvZ structure and dynamics:

These computational approaches, especially when integrated with experimental data, provide valuable insights into the structural basis of EnvZ function and its interactions with regulatory partners.

How can contradictory data in EnvZ research be reconciled when different experimental approaches yield conflicting results?

Researchers often encounter contradictory data when studying complex systems like EnvZ. Here's a methodological approach to reconciling such conflicts:

  • Critically Evaluate Experimental Conditions:

    • Different growth conditions, especially varying osmolarity regimes, can significantly impact EnvZ behavior. For example, certain EnvZ mutations show opposite effects under low versus high osmolarity .

    • Expression levels of EnvZ variants should be carefully monitored, as overexpression can mask subtle phenotypes or create artificial ones.

  • Consider Technical Limitations:

    • In vitro assays may not fully recapitulate the membrane environment crucial for EnvZ function.

    • Fluorescent reporter systems might have different sensitivities or dynamic ranges.

    • Protein tags can sometimes interfere with protein folding or interactions.

  • Integrate Multiple Approaches:

    • Combine in vivo functional assays (e.g., CFP/YFP reporter systems) with in vitro biochemical studies (kinase/phosphatase activity assays) and structural analyses .

    • Complement experimental data with computational modeling to test hypotheses about mechanisms .

    • Use both site-directed mutagenesis and random mutagenesis approaches to comprehensively map functional residues.

  • Analyze Context Dependencies:

    • Genetic background differences between strains can affect results (e.g., presence or absence of MzrA or other modulatory proteins) .

    • Consider the impact of specific mutations on multiple activities of EnvZ (kinase vs. phosphatase), as some mutations may selectively affect one function .

  • Develop Unifying Models:

    • Propose mechanistic models that can explain seemingly contradictory observations, such as the water encapsulation hypothesis that links structural features to signaling outcomes .

    • Test these models with targeted experiments designed to distinguish between competing hypotheses.

By systematically addressing these factors, researchers can often reconcile contradictory data and develop a more comprehensive understanding of EnvZ function.

What are the most significant recent advances in understanding EnvZ structure and function?

Recent significant advances in EnvZ research include:

  • Water-Mediated Signaling Mechanism: The discovery that EnvZ signal output correlates with the capacity for transmembrane water passage represents a major breakthrough. Research has identified specific water encapsulation motifs within the transmembrane domain that likely play a crucial role in osmosensing .

  • Structural Insights: AlphaFold-Multimer predictions combined with molecular dynamics simulations have provided detailed structural models of the EnvZ homodimer in membrane environments. These models have been validated against experimental crosslinking data, offering unprecedented insights into the organization of the four-helix bundle in the transmembrane domain .

  • Modulatory Protein Interactions: Advances in understanding how auxiliary proteins like MzrA interact with EnvZ to modulate its activity have revealed new layers of regulation in osmosensing pathways. Mapping studies have identified specific contact points between MzrA and EnvZ, expanding our understanding of the protein interaction network involved in osmotic regulation .

  • Systematic Mutational Analysis: Comprehensive cysteine-scanning mutagenesis of the transmembrane domains has revealed position-specific effects on EnvZ signal output, demonstrating alternating patterns of activation and inhibition that correlate with the helical structure of the transmembrane segments .

  • Integration of Computational and Experimental Approaches: The successful validation of computational models against experimental data has established a powerful framework for studying membrane protein dynamics and function, opening new avenues for investigating signal transduction mechanisms in histidine kinases .

These advances collectively represent significant progress toward understanding the molecular mechanisms underlying EnvZ's osmosensing function and its role in bacterial adaptation to environmental changes.

What are the most promising methodological approaches for future EnvZ research?

Several promising methodological approaches are likely to drive future EnvZ research:

  • Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized membrane protein structural biology and could provide high-resolution structures of full-length EnvZ in different conformational states, offering insights into the complete signaling mechanism.

  • Single-Molecule Techniques: Methods such as single-molecule FRET (smFRET) could track real-time conformational changes in EnvZ during osmosensing, providing dynamic information that complements static structural studies.

  • Advanced Computational Approaches: Integration of machine learning methods with molecular dynamics simulations will enhance our ability to model complex membrane systems and predict the effects of mutations or environmental changes on EnvZ function.

  • In-Cell NMR Spectroscopy: This emerging technique allows for the study of protein structure and dynamics in living cells, potentially providing insights into how EnvZ behaves in its native cellular environment.

  • Optogenetic Control of EnvZ Activity: Engineered light-sensitive variants of EnvZ would allow precise temporal control of signaling, facilitating the study of downstream effects and pathway kinetics.

  • CRISPR-Based Engineering: CRISPR-Cas technology enables precise genomic modifications, allowing researchers to study EnvZ function in various genetic backgrounds and to create reporter systems integrated at native loci.

  • Synthetic Biology Approaches: Reconstituting EnvZ/OmpR signaling in synthetic membrane systems or minimal cells could isolate the core functional elements from the complexity of the cellular environment.

  • Integration of Multi-Omics Data: Combining transcriptomics, proteomics, and metabolomics approaches can provide a systems-level understanding of how EnvZ/OmpR signaling impacts cellular physiology under different osmotic conditions.

These methodological advances will likely lead to more comprehensive models of EnvZ function and its role in bacterial osmoadaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.