Recombinant Escherichia coli Outer membrane protein A (ompA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Outer Membrane Protein A (OmpA)

Recombinant Escherichia coli Outer Membrane Protein A (OmpA) is a protein derived from the outer membrane of Escherichia coli, a Gram-negative bacterium. OmpA is one of the most abundant proteins in the outer membrane and plays a crucial role in maintaining the structural integrity and morphology of the bacterial cell. It also functions as a porin, facilitating the transport of small molecules across the membrane, and is involved in conjugation and bacteriophage binding .

Structure and Function of OmpA

OmpA is composed of three main functional domains: a hydrophilic extracellular mass, a beta-barrel transmembrane structure, and a peptidoglycan binding domain. The beta-barrel structure is essential for its function and stability in the outer membrane . OmpA's role in stress survival and its interaction with the Rcs stress response system highlight its importance in bacterial physiology and pathogenesis .

Recombinant Production of OmpA

Recombinant OmpA is produced by cloning the ompA gene from Escherichia coli into an expression vector and expressing it in a suitable host, such as E. coli BL21 (DE3) . The recombinant protein is typically purified using affinity chromatography, such as His-tag purification, to achieve high purity levels .

Immunogenicity and Vaccine Potential

Recombinant OmpA has been shown to induce a strong immune response and confer protection against Escherichia coli infections in animal models. It also exhibits cross-protection against other pathogens like Shigella and Salmonella, making it a promising candidate for the development of subunit vaccines . The protein enhances phagocytic activity against E. coli, further supporting its potential as a vaccine component .

Research Findings and Applications

Several studies have demonstrated the protective effects of recombinant OmpA fragments against Escherichia coli infections, including meningitis. Specific fragments of the N-terminal beta-barrel domain have been shown to protect mice from intracerebral E. coli infection . These findings suggest that recombinant OmpA could be used in therapeutic applications to prevent or treat severe bacterial infections.

Product Specs

Buffer
Lyophilized from a Tris/PBS-based buffer containing 6% trehalose.
Form
Available as liquid or lyophilized powder.
Note: We will prioritize shipment of the format currently in stock. Should you require a specific format, please specify this in your order notes; we will fulfill requests based on availability.
Lead Time
3-7 business days
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tag.
Synonyms
ompA; con; tolG; tut; b0957; JW0940; Outer membrane protein A; OmpA; Outer membrane porin A; Outer membrane protein 3A; Outer membrane protein B; Outer membrane protein II*; Outer membrane protein d
Datasheet & Coa
Please contact us to get it.
Expression Region
22-346aa
Mol. Weight
38.0 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Metabolism
Source
in vitro E.coli expression system
Species
Escherichia coli (strain K12)
Target Names
ompA
Target Protein Sequence
APKDNTWYTGAKLGWSQYHDTGFINNNGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGSVENGAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTKSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNNIGDAHTIGTRPDNGMLSLGVSYRFGQGEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKATLKPEGQAALDQLYSQLSNLDPKDGSVVVLGYTDRIGSDAYNQGLSERRAQSVVDYLISKGIPADKISARGMGESNPVTGNTCDNVKQRAALIDCLAPDRRVEIEVKGIKDVVTQPQA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Outer membrane protein A (OmpA) likely plays a crucial role in maintaining peptidoglycan cell wall localization within the periplasm. It contributes to environmental stress resistance and influences outer membrane function and cell shape. OmpA likely non-covalently binds peptidoglycan and functions as a low-permeability porin, permitting slow passage of small solutes. Highly abundant (up to 210,000 molecules per cell), only approximately 3% of reconstituted OmpA in unilamellar lipid vesicles exhibits an open conformation facilitating L-arabinose diffusion at a rate comparable to OmpF porin; pore interconversion is infrequent. Both native and reconstituted protein forms display ion channels with two conductance states (50-80 pS and 260-320 pS), interconvertible through periplasmic domain refolding. Elevated temperatures promote the conversion of small pores to large pores, potentially involving the formation of eight additional β-sheets in the C-terminal periplasmic domain to create a larger pore. The β-barrel's central core is polar and includes a gate (involving Glu-73, Lys-103, Glu-149, and Arg-159, flanked by Tyr-29, Phe-40, and Tyr-94), lacking an obvious pathway for water or ions. Gating involves the Glu-73-Arg-159 salt bridge; gate opening likely involves the formation of alternative salt bridges (Glu-149-Arg-159 and Glu-73-Lys-103). Modeling suggests that the non-covalent interaction of OmpA (outer membrane) and TolR (inner membrane) with peptidoglycan maintains cell wall periplasmic positioning, ensuring equal distance from both membranes. Trimeric Lpp potentially regulates periplasmic width, adjusting its tilt to accommodate available space and partially compensating for OmpA absence. OmpA is required for F plasmid conjugation; purified protein and lipopolysaccharide (LPS) inhibit conjugation in a concentration-dependent manner, with OmpA possibly serving as a receptor on recipient cells. OmpA stabilizes mating aggregates during F plasmid transfer and may interact with F plasmid-encoded TraN, but not R100-1 TraN. All four external, surface-exposed loops are needed for F plasmid conjugation. Mutations affecting OmpA confer resistance to bacteriophages (TuII*, K3, K4, K5, Ox2, Ox3, Ox4, Ox5, Ml, and Ac3), suggesting it serves as a receptor. A mutation (tolG) confers tolerance to bacteriocin JF246 without affecting colicin sensitivity. OmpA mutations impact susceptibility to colicins K and L.
Gene References Into Functions
  1. OmpA concatemers may fold directly or via domain swapping, potentially reverting to the denatured state or folding into the native concatemeric state. PMID: 27973779
  2. OmpA exhibits a multistep folding mechanism involving unstructured surface-adsorbed states transitioning through a partially inserted state with significant β-sheet structure to the final native inserted barrel. PMID: 28001375
  3. The periplasmic domain reduces the rate but enhances the efficiency of OmpA folding and membrane insertion under crowded conditions. PMID: 23225740
  4. Lipid solvation of tryptophans contributes to OmpA stability, as assessed by unfolding free energy calculations. PMID: 23763479
  5. E. coli OmpA+ infection upregulates Ecgp96 and TLR2 in human brain microvascular endothelial cells (HBMEC), while OmpA- E. coli upregulates TLR4. PMID: 22963587
  6. The OmpA periplasmic domain functions as an independent folding unit with a folding free energy of -6.2 (+/-0.1) kcal mol⁻¹ at 25°C. PMID: 21782315
  7. Glucose reduces ompA mRNA stability. PMID: 21840983
  8. Cellular invasion requires activation of host cytosolic phospholipase A2 (cPLA2α) by OmpA loops 1 and 2, but not loop 3. PMID: 21148506
  9. Disulfide bond formation and temperature significantly impact OmpA folding into its native large-pore configuration. PMID: 21069910
  10. Mutations in loops 1, 2, and 4 inhibit E. coli K1 invasion in HBMEC. PMID: 20851887
  11. OmpA single mutants S163 and S167 form narrower pores than wild-type OmpA. PMID: 20004640
  12. Electron microscopy visualized the SecB/OmpA complex, revealing an asymmetric binding pattern between the SecB tetramer and OmpA. PMID: 20170640
  13. Phage T4 infection destabilizes stable E. coli mRNAs, including lpp and ompA. PMID: 15476881
  14. Evidence suggests convergent evolution; OmpA is secreted during all growth phases, both in vesicles and as a soluble protein. PMID: 15595387
  15. The two-domain OmpA structure is a kinetically stable partially folded intermediate at lower temperatures; mature OmpA forms a large pore. PMID: 15850404
  16. Distinct regulatory circuits control growth phase- and growth rate-dependent ompA mRNA stability. PMID: 16313626
  17. OmpA is post-transcriptionally regulated by RNase R. PMID: 16556233
  18. Bacteriophage resistance is associated with isolates containing a novel ompA allele. PMID: 16980421
  19. In dihexanoylphosphatidylcholine micelles, the β-barrel platform (BBP) and BBP plus EF motif are eight-stranded antiparallel β-barrels. PMID: 17260943
  20. OmpA functions as an adhesin, invasin, participates in biofilm formation, acts as an immune target and evasin, and serves as a bacteriophage receptor. PMID: 17559395
  21. Polarity analysis of the secretory protein proOmpA and protein-conducting channel SecYEG. PMID: 17699162
  22. Stat3 activation and its interaction with Ec-gp96, which interacts with E. coli OmpA, are crucial for E. coli invasion. PMID: 18662321
  23. When bound to Skp, OmpA's β-barrel domain remains unfolded, while the periplasmic domain is folded, facilitating periplasmic transport of unfolded β-barrels. PMID: 19181847
  24. Negatively charged lipopolysaccharide partially releases OmpA from OmpA-Skp complexes; turn regions remain bound to Skp. PMID: 19382746
Database Links
Protein Families
OmpA family
Subcellular Location
Cell outer membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of E. coli OmpA?

E. coli OmpA is a 35-kDa protein consisting of two distinct domains: an N-terminal β-barrel transmembrane domain (residues 1-171) that anchors into the outer membrane, and a C-terminal periplasmic domain (residues 172-325) that interacts with the peptidoglycan layer. The N-terminal domain forms an eight-stranded antiparallel β-barrel structure that spans the outer membrane, with four extracellular loops and three periplasmic turns. The C-terminal domain contains a globular structure that binds to the peptidoglycan cell wall, creating a mechanical link between the outer membrane and cell wall .

How conserved is OmpA across different E. coli strains?

OmpA is highly conserved across different E. coli strains, including pathogenic variants like E. coli O157:H7. This conservation makes it an attractive target for broad-spectrum vaccine development and antimicrobial strategies. Sequence analysis shows that the transmembrane β-barrel region exhibits particularly high conservation, while some variation occurs in the extracellular loops which interact with the external environment and host cells .

What are the key functional regions of OmpA that contribute to bacterial adhesion?

The extracellular loops of OmpA, particularly loops 1, 2, and 4, play significant roles in bacterial adhesion to host cells. These loops contain specific amino acid sequences that facilitate binding to extracellular matrix components and intestinal epithelial cell receptors. Additionally, regions within the β-barrel domain contribute to OmpA's ability to mediate bacterial aggregation, which enhances colonization and biofilm formation. Functional studies have demonstrated that antibodies targeting these regions can effectively reduce bacterial adhesion to intestinal epithelial cells .

What are the primary functions of OmpA in E. coli?

OmpA serves multiple essential functions in E. coli:

  • Maintaining outer membrane integrity and stability

  • Organizing the outer membrane protein lattice

  • Providing a mechanical connection between the outer membrane and peptidoglycan layer

  • Facilitating bacterial adhesion to host cells and extracellular matrix components

  • Contributing to bacterial conjugation and bacteriophage recognition

  • Enhancing survival under osmotic stress conditions

  • Participating in biofilm formation and bacterial aggregation

These functions collectively contribute to bacterial survival, virulence, and host colonization .

How does OmpA contribute to the mechanical properties of the bacterial cell envelope?

OmpA integrates the compressive properties of the OM protein lattice with the tensile strength of the cell wall, forming a mechanically robust composite structure. By linking these two layers, OmpA allows forces to be distributed across the entire cell envelope. This mechanical coupling is critical when bacteria face external stresses such as osmotic changes or physical forces. Experimental evidence using atomic force microscopy has demonstrated that cells lacking functional OmpA show decreased envelope integrity and reduced ability to withstand mechanical stress. Both the β-barrel domain and the cell wall-binding domain are necessary for full mechanical enhancement of the cell envelope .

What approaches have been used for computational redesign of OmpA, and what were the outcomes?

Computational redesign of OmpA has employed Monte Carlo algorithms to optimize the lipid-facing surfaces. This process involves:

  • Identification of lipid-facing amino acids from crystal structures

  • Application of energy functions that reward depth-appropriate amino acid choices

  • Implementation of sequence complexity terms to maintain amino acid diversity

  • Optimization of the protein's relative stability within the membrane

One notable approach utilized the following scoring function for designs OR1-OR3:
Score=w1Eβz+w2Sequence Complexity\text{Score} = w_1 \cdot E_{\beta z} + w_2 \cdot \text{Sequence Complexity}

For design OR4, an additional term was included to account for membrane positioning:
Score=w1Eβz+w2Sequence Complexity+w3P(centered)\text{Score} = w_1 \cdot E_{\beta z} + w_2 \cdot \text{Sequence Complexity} + w_3 \cdot P(\text{centered})

Despite successful computational design and expression of redesigned variants (OR1-OR4) in OmpA-knockout E. coli, none of the completely redesigned proteins folded correctly in vivo. The proteins were observed in periplasmic and outer membrane fractions, suggesting issues with folding rather than trafficking. These results highlight the complexity of designing functional outer membrane proteins and the limitations of current computational approaches .

How can fractional factorial experimental design be applied to assess OmpA strand contributions to proper folding?

Fractional factorial experimental design provides an efficient approach to assess which strands of OmpA most significantly affect folding without testing all possible strand combinations. The methodology involves:

  • Creating backcross hybrids containing mixtures of wild-type and designed strands

  • Using a fractional factorial strategy to reduce the number of required experiments (from 2^8=256 down to 64 or fewer)

  • Assessing phage susceptibility as a functional readout for proper folding

  • Applying ANOVA calculations to estimate the effect of each strand on folding

This approach allows researchers to identify critical regions that influence folding while minimizing experimental complexity. For example, a study employed 14 of the 70 possible backcross hybrids containing four wild-type and four mutant strands, along with the wild-type and redesigned versions of OmpA, to determine strand-specific contributions to folding. The analysis revealed that β-strands 3 and 6 were particularly significant for proper folding, with potential cooperative effects between these strands and strands 1 or 4 .

What evidence supports OmpA as a vaccine candidate against pathogenic E. coli?

Several lines of evidence support OmpA as a promising vaccine candidate against pathogenic E. coli:

  • High conservation across E. coli strains, enabling broad-spectrum protection

  • Surface exposure and accessibility to the immune system

  • Essential role in bacterial virulence and adhesion

  • Immunogenicity and ability to elicit protective antibody responses

Experimental studies have demonstrated that antibodies raised against recombinant OmpA effectively reduce the adhesion of E. coli O157:H7 to intestinal epithelial cells, a critical first step in colonization and pathogenesis. Additionally, immunization with OmpA has been shown to induce protective immunity in animal models, reducing bacterial colonization and disease severity. These findings suggest that OmpA-based vaccines could provide protection against multiple pathogenic E. coli strains, particularly those causing intestinal infections .

What are the key considerations in designing OmpA-based vaccine constructs?

Designing effective OmpA-based vaccine constructs requires careful consideration of several factors:

  • Antigenic region selection: Identifying immunodominant epitopes within OmpA that elicit protective immune responses, particularly those in surface-exposed loops

  • Expression system optimization: Developing expression systems that maintain the native conformation of critical epitopes, potentially using membrane-mimetic environments

  • Adjuvant selection: Choosing appropriate adjuvants to enhance immunogenicity and direct the immune response toward protective mechanisms

  • Delivery platform: Evaluating different delivery platforms (e.g., recombinant protein, DNA vaccines, viral vectors) for optimal immune activation

  • Cross-reactivity analysis: Assessing potential cross-reactivity with commensal bacteria to minimize adverse effects

  • Stability and formulation: Ensuring vaccine stability under storage conditions and developing formulations that maintain epitope structure

The design process should prioritize epitopes involved in bacterial adhesion to maximize the functional impact of vaccine-induced antibodies .

How does OmpA contribute to outer membrane organization and what techniques can assess this function?

OmpA plays a crucial role in organizing the outer membrane protein lattice by:

  • Remaining immobile within the membrane

  • Making sequence-dependent interactions in the outer leaflet

  • Creating stable connections with surrounding outer membrane proteins (OMPs) or lipopolysaccharides (LPS)

  • Binding to the peptidoglycan layer, anchoring the membrane

Advanced techniques to assess OmpA's role in membrane organization include:

  • Atomic Force Microscopy (AFM): Provides nanoscale visualization of membrane organization and mechanical properties

  • Single-molecule tracking: Monitors OmpA mobility and interactions within the membrane

  • Gene fusion approaches: Creates chimeric proteins to assess domain-specific contributions

  • Microfluidic systems: Tests mechanical properties under controlled flow conditions

  • Computational simulations: Models OmpA interactions with membrane components

Research using these approaches has demonstrated that both the β-barrel domain and cell wall-binding domain of OmpA are necessary for proper membrane organization. The β-barrel is critical for maintaining the permeability barrier, while the connection to the cell wall enhances the strength of the entire envelope structure .

What are the optimal expression systems for producing functional recombinant OmpA?

Several expression systems have been developed for producing functional recombinant OmpA, each with specific advantages:

  • E. coli-based expression systems:

    • BL21(DE3) with pET vectors for high-yield expression

    • C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • Temperature-controlled expression (typically 16-25°C) to facilitate proper folding

    • IPTG concentration optimization (typically 0.1-0.5 mM) to balance expression and toxicity

  • Cell-free expression systems:

    • Enable direct incorporation into artificial membranes or nanodiscs

    • Avoid cellular toxicity issues that may occur with overexpression

    • Allow incorporation of non-natural amino acids for specialized studies

  • Optimization strategies:

    • N-terminal fusion with periplasmic targeting sequences (21 amino acids) to facilitate proper trafficking

    • C-terminal tagging (His, FlAsH) for purification while preserving N-terminal folding

    • Soluble C-terminal domain removal for β-barrel-focused studies

    • Co-expression with chaperones to enhance proper folding

When producing OmpA for structural or functional studies, it's critical to verify proper folding through techniques such as circular dichroism, tryptophan fluorescence, or phage susceptibility assays .

What purification strategies yield the highest quality recombinant OmpA for structural and functional studies?

High-quality recombinant OmpA requires tailored purification strategies:

  • Initial extraction:

    • Selective outer membrane isolation using sucrose density gradient centrifugation

    • Extraction with mild detergents (n-octyl-β-D-glucopyranoside, LDAO, or DDM) to maintain native conformation

    • Differential solubilization of inner and outer membranes using selective detergents

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Ion exchange chromatography to separate different folding states

    • Size exclusion chromatography for final polishing and buffer exchange

  • Quality assessment methods:

    • Heat-modifiable mobility on SDS-PAGE (properly folded OmpA shows different migration patterns before and after heat denaturation)

    • Circular dichroism to verify secondary structure (high β-sheet content)

    • Tryptophan fluorescence to assess tertiary structure

    • Dynamic light scattering to confirm monodispersity

  • Reconstitution into membrane mimetics:

    • Liposomes with E. coli lipid extract for functional studies

    • Nanodiscs for single-molecule analyses

    • Crystallization screens for structural studies

The purification protocol should be optimized based on the intended application, with structural studies typically requiring higher purity and homogeneity than functional assays .

How can researchers assess the adhesion properties of recombinant OmpA variants?

Researchers can employ multiple complementary approaches to assess adhesion properties of recombinant OmpA variants:

  • Cell-based adhesion assays:

    • Quantification of bacterial adhesion to intestinal epithelial cell lines (e.g., Caco-2, HT-29)

    • Flow cytometry-based analysis of bacteria-host cell interactions

    • Microscopy visualization using fluorescently labeled bacteria

    • Competitive inhibition assays with soluble recombinant OmpA

  • Extracellular matrix (ECM) binding assays:

    • ELISA-based quantification of binding to immobilized ECM components (collagen, fibronectin)

    • Surface plasmon resonance to measure binding kinetics

    • Proteomic approaches to recover and identify surface components specifically binding to ECM components

  • Antibody inhibition studies:

    • Generation of antibodies against recombinant OmpA

    • Assessment of antibody-mediated inhibition of bacterial adhesion

    • Epitope mapping to identify critical adhesion determinants

  • Aggregation assays:

    • Quantification of bacterial auto-aggregation mediated by OmpA

    • Light scattering measurements of aggregation kinetics

    • Microscopy visualization of bacterial clumping

These approaches can be applied to compare wild-type OmpA with site-directed mutants or domain swap variants to map the specific regions responsible for adhesion functions .

What methods can effectively evaluate the mechanical properties of OmpA in the bacterial envelope?

Evaluating the mechanical properties of OmpA in the bacterial envelope requires specialized techniques:

These methodologies have revealed that both the β-barrel domain and cell wall-binding domain of OmpA are necessary for the full mechanical enhancement of the cell envelope, with the combination forming a composite material that distributes mechanical loads across the envelope layers .

What are the major unresolved questions regarding OmpA structure-function relationships?

Despite extensive research, several important questions regarding OmpA remain unresolved:

  • The precise molecular mechanisms by which OmpA organizes the outer membrane protein lattice

  • The dynamic nature of OmpA's interaction with the peptidoglycan layer under different environmental conditions

  • The complete set of host receptors recognizing OmpA during pathogenesis

  • The structural basis for the species-specific differences in OmpA function across diverse Gram-negative bacteria

  • The regulatory mechanisms controlling OmpA expression during different growth phases and stress conditions

  • The potential role of OmpA in antibiotic resistance mechanisms

  • The evolutionary pathway that led to OmpA's dual functionality in membrane organization and cell wall connection

Addressing these questions will require integrative approaches combining structural biology, genetics, biophysics, and computational modeling .

How might emerging technologies advance our understanding of OmpA?

Emerging technologies poised to advance OmpA research include:

  • Cryo-electron tomography: Visualizing OmpA organization within the native bacterial envelope at near-atomic resolution

  • Single-molecule tracking: Monitoring OmpA dynamics and interactions in living cells

  • In-cell NMR: Characterizing OmpA structure and dynamics in intact bacteria

  • Mass spectrometry-based crosslinking: Mapping OmpA interaction networks within the membrane

  • AlphaFold and other AI approaches: Predicting OmpA structural variations and interactions

  • CRISPR-based screening: Identifying genetic interactions affecting OmpA function

  • High-throughput mutagenesis: Comprehensively mapping functional regions of OmpA

  • Nanobody development: Creating tools to probe specific OmpA conformations or interactions

These technologies hold promise for resolving long-standing questions about OmpA structure, dynamics, and function in the bacterial envelope .

How can OmpA research contribute to antimicrobial development strategies?

OmpA research offers multiple avenues for antimicrobial development:

  • Vaccine approaches:

    • Subunit vaccines using recombinant OmpA or peptide epitopes

    • DNA vaccines encoding OmpA immunogenic regions

    • Attenuated live vaccines with engineered OmpA variants

  • Antibody-based therapeutics:

    • Monoclonal antibodies targeting OmpA adhesion epitopes

    • Antibody-antibiotic conjugates for targeted delivery

    • Bispecific antibodies engaging immune effector functions

  • Small molecule inhibitors:

    • Compounds disrupting OmpA-mediated adhesion

    • Molecules interfering with OmpA-peptidoglycan interactions

    • Agents that alter OmpA conformation or oligomerization

  • Phage-based approaches:

    • Engineered bacteriophages targeting OmpA-dependent entry

    • Phage lysins that access peptidoglycan via OmpA disruption

  • Antimicrobial peptides:

    • Peptides designed to interact with OmpA to disrupt membrane integrity

    • Cell-penetrating peptides utilizing OmpA-dependent mechanisms

These strategies could potentially overcome resistance mechanisms by targeting a highly conserved protein essential for bacterial virulence and survival .

What experimental design considerations are critical for translating OmpA research to clinical applications?

Translating OmpA research to clinical applications requires careful experimental design:

  • Target validation:

    • Confirmation of OmpA conservation across clinical isolates

    • Verification of OmpA essentiality in relevant infection models

    • Assessment of potential resistance mechanisms

  • Model system selection:

    • Use of clinically relevant strains rather than laboratory-adapted ones

    • Employment of appropriate animal models that recapitulate human disease

    • Development of ex vivo tissue models for host-pathogen interactions

  • Efficacy metrics:

    • Establishment of clear endpoints related to clinical outcomes

    • Comparison with current standard-of-care treatments

    • Evaluation of combinatorial approaches with existing antibiotics

  • Safety considerations:

    • Assessment of cross-reactivity with human proteins

    • Evaluation of effects on commensal bacteria

    • Testing for immune-related adverse events with vaccine approaches

  • Manufacturing and formulation:

    • Development of scalable production methods for recombinant OmpA

    • Stability testing under clinically relevant conditions

    • Formulation optimization for specific administration routes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.