Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

The protein AaeA, or p-hydroxybenzoic acid efflux pump subunit AaeA, is a protein component of an efflux pump found in Escherichia coli . Efflux pumps are biological mechanisms that bacteria use to transport compounds, such as antibiotics and toxins, out of the cell . AaeA functions with AaeB to form an efflux pump that eliminates specific compounds when they accumulate to high levels within the cell . The substrate of the AaeA/AaeB efflux pump is p-hydroxybenzoic acid (pHBA) .

Structure and Function

AaeA is a protein that consists of 310 amino acids . It functions as a metabolic relief valve, helping the bacterium to eliminate excess compounds . It is a component of the p-hydroxybenzoic acid efflux system, where it forms an efflux pump in conjunction with AaeB .

Proteins are composed of amino acid chains, and their structure determines their function . The interactions between amino acids result in twists, folds, and coils that give each protein a distinct tertiary structure, which, in turn, determines how it interacts with other molecules .

Genetics and Regulation

The aaeA gene, also known as ECSE_3520, encodes the AaeA protein . AaeA is part of the aaeXAB operon, and its expression is regulated by the transcriptional regulator AaeR . AaeR activates transcription of the aaeXAB operon .

Interaction Network

AaeA interacts with several other proteins in E. coli, including:

  • AaeB: Forms an efflux pump with AaeA and acts as a metabolic relief valve .

  • AaeX: An inner membrane efflux pump-associated protein .

  • AaeR: A transcriptional regulator that activates the aaeXAB operon .

  • MacB: Part of the MacAB-TolC tripartite efflux system involved in macrolide resistance .

  • YeeZ: A putative enzyme of sugar metabolism .

  • EmrY: Part of the EmrYK-TolC tripartite efflux system, which confers resistance to various drugs .

  • YdhK: A component of the YdhJK efflux pump .

  • EmrB: Part of the EmrAB-TolC tripartite efflux system, which confers resistance to antibiotics .

  • TolC: An outer membrane channel required for the function of several efflux systems .

  • YhcO: A putative barnase inhibitor .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
aaeA; yhcQ; b3241; JW3210; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGVRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Gene References Into Functions
  1. The role of p-hydroxybenzoic acid in normal E. coli metabolism and the tightly regulated expression of the AaeAB efflux system suggest a physiological function as a "metabolic relief valve," mitigating the toxic effects of metabolic imbalances. [AaeA] PMID: 15489430
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AaeA subunit and what is its role in E. coli?

AaeA (formerly known as YhcQ) functions as a membrane fusion protein that forms part of the AaeAB efflux pump system in Escherichia coli. It works in conjunction with AaeB (formerly YhcP), which is the primary efflux protein component. Together, they form a transport system that exports aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA), out of the bacterial cell. This system appears to serve as a "metabolic relief valve" that helps alleviate the toxic effects of imbalanced metabolism by removing potentially harmful aromatic carboxylic acid compounds from the cellular environment .

How was the AaeA subunit initially identified and characterized?

The AaeA subunit was initially identified as YhcQ before being renamed. Researchers discovered it through gene expression studies that showed upregulation of yhcP (now aaeB), yhcQ (now aaeA), and yhcR (now aaeX) when E. coli was treated with p-hydroxybenzoic acid. The functional characterization involved creating mutant strains lacking these genes and observing their increased sensitivity to pHBA. The upstream regulatory gene yhcS (now aaeR) was also identified as controlling the expression of these genes. Through systematic testing of hundreds of diverse compounds, researchers determined that only a few aromatic carboxylic acids served as substrates for this efflux system, leading to the renaming of these genes to reflect their specific role in aromatic carboxylic acid efflux .

What is the genetic organization of the aae operon in E. coli?

The aae operon consists of four genes: aaeR, aaeX, aaeA, and aaeB. The aaeR gene is divergently transcribed from the others and encodes a regulatory protein of the LysR family. The aaeX gene encodes a small protein without a clearly defined function. The aaeA gene encodes the membrane fusion protein component of the efflux pump, while aaeB encodes the primary efflux protein. This genetic organization allows for coordinated expression and regulation of the components necessary for aromatic carboxylic acid efflux in response to environmental stimuli .

How can one express and purify recombinant AaeA protein for structural studies?

For recombinant expression and purification of AaeA, a recommended approach is to:

  • Clone the aaeA gene into an expression vector with an N-terminal His-tag (pET28a or similar)

  • Transform the construct into an E. coli expression strain (BL21(DE3) or Rosetta)

  • Optimize expression conditions:

    • Culture in LB medium at 37°C until OD600 reaches 0.6-0.8

    • Induce with 0.5-1.0 mM IPTG

    • Lower temperature to 18-25°C for overnight expression

  • Harvest cells by centrifugation (5,000 g for 15 minutes at 4°C)

  • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM PMSF)

  • Lyse cells via sonication or French press

  • Purify using nickel affinity chromatography:

    • Equilibrate Ni-NTA column with binding buffer

    • Apply clarified lysate

    • Wash with increasing imidazole concentrations (20-50 mM)

    • Elute protein with high imidazole (250-300 mM)

  • Further purify using size exclusion chromatography to obtain monodisperse protein

  • Verify purity by SDS-PAGE and Western blotting using anti-His antibodies

This methodology ensures obtaining functionally relevant protein for crystallography, biochemical assays, or interaction studies .

What are effective methods to study AaeA-AaeB interactions in the efflux pump complex?

To study AaeA-AaeB interactions in the efflux pump complex, several complementary approaches can be employed:

  • Bacterial Two-Hybrid System:

    • Clone aaeA and aaeB into compatible two-hybrid vectors

    • Co-transform into a reporter strain

    • Measure interaction strength through reporter gene activation

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of AaeA and AaeB in E. coli

    • Lyse cells under gentle conditions to maintain protein-protein interactions

    • Immunoprecipitate using antibodies against one tag

    • Detect the interacting partner via Western blotting

  • Fluorescence Resonance Energy Transfer (FRET):

    • Create fluorescent protein fusions (e.g., AaeA-CFP and AaeB-YFP)

    • Express in E. coli and measure energy transfer between fluorophores

    • Calculate FRET efficiency to quantify interaction

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified AaeA on a sensor chip

    • Flow purified AaeB over the surface at different concentrations

    • Determine binding kinetics (kon and koff rates) and affinity (KD)

  • Site-Directed Mutagenesis Combined with Functional Assays:

    • Introduce mutations at predicted interaction interfaces

    • Assess the impact on pump assembly and efflux activity

    • Map critical residues for complex formation

These methods provide complementary information about the structural and functional relationship between AaeA and AaeB components in the efflux system .

How can gene knockout and complementation approaches be utilized to study AaeA function?

Gene knockout and complementation studies are powerful approaches to study AaeA function:

  • Gene Knockout Strategy:

    • Create a precise aaeA deletion using λ Red recombinase system

    • Replace the gene with an antibiotic resistance marker

    • Verify deletion by PCR and sequencing

    • Assess phenotypic changes:

      • Measure sensitivity to p-hydroxybenzoic acid and other aromatic carboxylic acids

      • Evaluate growth kinetics under normal and stressed conditions

      • Analyze metabolite accumulation using LC-MS

  • Complementation Approach:

    • Clone wild-type aaeA into a low-copy plasmid under an inducible promoter

    • Transform the plasmid into the ΔaaeA strain

    • Induce expression at varying levels to assess dose-dependent complementation

    • Compare with wild-type to confirm restoration of function

    • Create point mutations to identify critical residues

  • Dual Knockout Analysis:

    • Generate ΔaaeA/ΔaaeB double mutant

    • Compare phenotypes with single mutants to assess synergistic effects

    • Complement with individual genes to determine which functions are interdependent

This approach revealed that a yhcP (aaeB) mutant strain showed hypersensitivity to pHBA, and that expression of both yhcQ (aaeA) and yhcP (aaeB) was necessary and sufficient to suppress pHBA hypersensitivity in a yhcS (aaeR) mutant, demonstrating their coordinated function in the efflux system .

What is the regulatory mechanism controlling aaeA expression in response to p-hydroxybenzoic acid?

The expression of aaeA is regulated through a sophisticated mechanism involving several components:

  • Primary Regulation by AaeR:

    • AaeR (formerly YhcS) is a LysR-type transcriptional regulator encoded by a divergently transcribed gene

    • Upon binding aromatic carboxylic acids like pHBA, AaeR undergoes conformational changes

    • Activated AaeR binds to the promoter region of the aaeXAB operon, inducing transcription

    • The binding site likely contains a conserved LysR recognition element (LRE)

  • Secondary Regulatory Elements:

    • Global regulators such as H-NS may be involved in silencing the aaeXAB operon under non-inducing conditions

    • This is supported by findings in the related EefABC system in K. aerogenes, where H-NS mediates transcriptional silencing

  • Induction Dynamics:

    • Treatment with pHBA results in rapid upregulation of the aaeXAB operon

    • Multiple aromatic carboxylic acids can serve as inducers, but with varying efficiencies

    • The induction is specific, as only a few compounds among hundreds tested were effective

  • Feedback Mechanisms:

    • The efflux of the inducing compounds by AaeAB may create a negative feedback loop

    • Once sufficient export capacity is established, the intracellular concentration of inducers decreases, potentially moderating expression

This regulatory system ensures that the expression of the energy-consuming efflux pump is tightly controlled and only activated when necessary to alleviate the toxic effects of aromatic carboxylic acids .

How does the structure of AaeA compare with other membrane fusion proteins in bacterial efflux systems?

The structure of AaeA can be compared with other membrane fusion proteins (MFPs) in bacterial efflux systems through several key features:

  • Domain Organization:

    • Like other MFPs, AaeA likely possesses a membrane-proximal domain, a β-barrel domain, a lipoyl domain, and an α-hairpin domain

    • The α-hairpin domain typically forms coiled-coil structures that interact with outer membrane factors

    • The membrane-proximal domain anchors to the inner membrane and interacts with the RND transporter

  • Structural Distinctions:

    • While AaeA belongs to the MFP family, its sequence suggests specific adaptations for aromatic carboxylic acid efflux

    • Homology modeling would likely reveal differences in the substrate binding pocket compared to multidrug efflux MFPs like AcrA

  • Oligomeric State:

    • Most MFPs function as trimers or hexamers in assembled efflux complexes

    • AaeA likely forms similar oligomeric structures to create a channel connecting the inner and outer membrane components

  • Comparative Analysis with RND System MFPs:

    • AaeA would differ from MFPs associated with RND transporters like AcrA

    • While the EefA protein described in search result is an MFP associated with the RND family, AaeA is part of a different transporter family

    • The structural differences reflect the specialization of each system for specific substrates

  • Evolutionary Conservation:

    • AaeA shows phylogenetic conservation patterns distinct from those of other MFPs

    • While RND systems like EefABC show high conservation within specific E. coli lineages (97.7% sequence identity), the conservation pattern of AaeA would reflect its specialized function

A detailed structural comparison would require crystallographic data or high-quality homology models, but sequence analysis and functional studies suggest that AaeA has evolved specific structural features suited to its role in aromatic carboxylic acid efflux .

What is the physiological role of the AaeAB efflux system in normal E. coli metabolism?

The physiological role of the AaeAB efflux system extends beyond simple xenobiotic export and appears to be integrated into normal E. coli metabolism:

  • Metabolic Relief Valve Function:

    • The AaeAB system likely serves as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism

    • During normal metabolism, E. coli produces aromatic compounds including pHBA as intermediates or byproducts

    • When these compounds accumulate to potentially harmful levels, the AaeAB system exports them to maintain homeostasis

  • Regulation of Aromatic Compound Flux:

    • By controlling the intracellular concentration of aromatic carboxylic acids, AaeAB may indirectly regulate metabolic pathways

    • This regulation could be particularly important during shifts in carbon source utilization or under stress conditions

  • Stress Response Integration:

    • The system likely interfaces with broader stress response networks

    • Upregulation during metabolic stress suggests coordination with other cellular responses

  • Substrate Specificity Implications:

    • The high specificity of AaeAB for aromatic carboxylic acids (only a few compounds from hundreds tested)

    • This narrow substrate range contrasts with broad-spectrum pumps like AcrAB-TolC

    • The specificity indicates a precise physiological role related to particular metabolic pathways

  • Comparison with Other Efflux Systems:

    • Unlike RND systems like EefABC that may be involved in host infection contexts

    • AaeAB appears more focused on core metabolic functions

This physiological role as a metabolic regulator rather than primarily an antimicrobial resistance determinant represents an important distinction from many other efflux systems .

What assay systems can be used to measure AaeA-mediated efflux activity?

Several assay systems can be employed to measure AaeA-mediated efflux activity:

  • Fluorescent Substrate Accumulation Assay:

    • Culture cells expressing AaeAB in medium with a fluorescent substrate analog

    • Measure intracellular fluorescence accumulation over time

    • Compare wild-type, ΔaaeA mutant, and complemented strains

    • Data can be presented as fluorescence units over time:

    Time (min)Wild-type E. coliΔaaeA MutantComplemented ΔaaeA
    0100100100
    5120180125
    10135250140
    15145320155
    30150450160
  • Radiolabeled Substrate Transport Assay:

    • Culture cells in the presence of 14C-labeled p-hydroxybenzoic acid

    • Collect samples at various time points

    • Measure intracellular and extracellular radioactivity

    • Calculate efflux rate as a function of AaeA expression level

  • Growth Inhibition Assay:

    • Expose wild-type, ΔaaeA, and complemented strains to increasing concentrations of p-hydroxybenzoic acid

    • Monitor growth (OD600) over time

    • Calculate IC50 values for each strain

    • Example comparative data:

    StrainpHBA IC50 (mM)
    Wild-type E. coli12.5
    ΔaaeA Mutant3.2
    ΔaaeB Mutant2.8
    ΔaaeA/ΔaaeB Mutant2.7
    Complemented ΔaaeA11.8
  • Real-time Efflux Assay:

    • Load cells with a pH-sensitive fluorescent probe

    • Add substrate and monitor fluorescence changes

    • Correlate signal with proton-coupled efflux activity

  • Inside-Out Membrane Vesicle Transport Assay:

    • Prepare inside-out membrane vesicles from cells expressing AaeAB

    • Incubate with substrate in the presence of an energy source (ATP or NADH)

    • Measure substrate accumulation within vesicles over time

These methodologies provide complementary data on the kinetics, substrate specificity, and energetics of AaeA-mediated efflux .

How can transcriptional regulation of the aaeA gene be studied?

Studying the transcriptional regulation of aaeA involves several complementary approaches:

  • Promoter-Reporter Fusion Systems:

    • Clone the promoter region upstream of aaeA into a reporter vector (lacZ, gfp, or luciferase)

    • Transform into wild-type E. coli and regulatory mutants (ΔaaeR)

    • Expose to potential inducers (pHBA and other aromatic carboxylic acids)

    • Measure reporter activity under different conditions

    • Example data table showing relative promoter activity:

    ConditionPromoter Activity (Miller Units)
    Basal (no inducer)15 ± 3
    + 5 mM pHBA342 ± 28
    + 5 mM benzoic acid287 ± 31
    + 5 mM salicylic acid195 ± 22
    + 5 mM 2,4-dihydroxybenzoate56 ± 8
    ΔaaeR (no inducer)8 ± 2
    ΔaaeR + 5 mM pHBA12 ± 4
  • RT-qPCR Analysis:

    • Extract RNA from cells under various conditions

    • Perform reverse transcription and quantitative PCR

    • Normalize aaeA expression to housekeeping genes

    • Compare expression levels between wild-type and regulatory mutants

    • Analyze time-course of induction

  • Chromatin Immunoprecipitation (ChIP):

    • Express epitope-tagged AaeR in E. coli

    • Induce with pHBA or other aromatic carboxylic acids

    • Cross-link protein-DNA complexes

    • Immunoprecipitate AaeR-bound DNA

    • Sequence or perform qPCR to identify binding sites

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Purify recombinant AaeR protein

    • Generate labeled DNA fragments containing the aaeA promoter region

    • Incubate DNA with varying concentrations of AaeR

    • Analyze complex formation by gel electrophoresis

    • Include potential inducers to assess their effect on binding

  • DNase I Footprinting:

    • Generate end-labeled DNA fragments containing the aaeA promoter

    • Incubate with purified AaeR protein

    • Treat with DNase I

    • Analyze protected regions by sequencing gel

    • Identify specific binding sites within the promoter

This comprehensive approach revealed that aromatic carboxylic acid compounds serve as inducers of yhcRQP (now aaeXAB) expression and that the upstream gene yhcS (now aaeR) plays a regulatory role .

What high-throughput approaches can identify novel substrates or inhibitors of the AaeAB efflux system?

High-throughput approaches can systematically identify novel substrates or inhibitors of the AaeAB efflux system:

  • Chemical Library Screening:

    • Utilize a reporter strain with aaeA promoter fused to luciferase

    • Screen compound libraries for induction or inhibition of luminescence

    • Primary hits can be classified as:

      • Potential substrates (inducers of expression)

      • Potential inhibitors (compounds that block induction)

    • Example screening results:

    Compound ClassTotal TestedInducersInhibitorsNon-active
    Aromatic carboxylic acids7512261
    Non-aromatic carboxylic acids520052
    Phenolic compounds688357
    Quinones236116
    Heterocyclics11227103
  • Growth-Based Screening:

    • Compare growth of wild-type and ΔaaeA strains in the presence of compound libraries

    • Identify compounds that selectively inhibit growth of the ΔaaeA strain

    • Validate hits through dose-response studies and direct efflux assays

  • Fluorescent Dye Efflux Competition Assay:

    • Load cells with a fluorescent substrate of AaeAB

    • Add test compounds and monitor changes in fluorescence retention

    • Compounds that compete for efflux will increase intracellular fluorescence

  • Computational Approaches:

    • Develop QSAR (Quantitative Structure-Activity Relationship) models based on known substrates

    • Perform virtual screening of chemical databases

    • Dock candidates to homology models of the AaeAB binding pocket

    • Validate top computational hits experimentally

  • Metabolomics Screening:

    • Compare metabolite profiles of wild-type and ΔaaeA strains

    • Identify differentially accumulated compounds using LC-MS or GC-MS

    • Confirm direct transport through in vitro assays

This systematic approach allows for the identification of both substrates and inhibitors of the AaeAB system. The original characterization showed that only a few aromatic carboxylic acids from hundreds of diverse compounds tested were substrates of the YhcQP (now AaeAB) efflux pump, highlighting the importance of comprehensive screening approaches .

How can one address difficulties in expressing functional recombinant AaeA protein?

Addressing difficulties in expressing functional recombinant AaeA protein requires systematic troubleshooting:

  • Expression System Optimization:

    • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3), Rosetta)

    • Compare expression vectors with different promoters (T7, tac, ara)

    • Optimize codon usage for E. coli expression

    • Try fusion tags beyond His-tag (MBP, SUMO, GST) to enhance solubility

    • Example comparison of expression systems:

    Expression SystemProtein Yield (mg/L)Solubility (%)Functionality
    BL21(DE3)/pET28a2.530Low
    C41(DE3)/pET28a4.245Moderate
    Rosetta/pET28a3.840Moderate
    BL21(DE3)/pMAL-c5X8.575High
    BL21(DE3)/pETSUMO6.265High
  • Expression Condition Optimization:

    • Test multiple induction temperatures (16°C, 25°C, 30°C, 37°C)

    • Vary IPTG concentration (0.1 mM to 1 mM)

    • Try different media compositions (LB, TB, 2xYT, minimal media)

    • Test effects of additives (glycerol, sorbitol, ethanol, benzyl alcohol)

    • Optimize cell density at induction (OD600 0.4-1.0)

  • Solubilization Strategies:

    • Screen detergents for membrane protein extraction:

      • Mild detergents: DDM, LMNG, DMNG

      • Medium detergents: DM, UDM

      • Harsh detergents: SDS, FC-12

    • Test detergent concentrations and buffer compositions

    • Consider nanodiscs or amphipols for stabilization

  • Purification Optimization:

    • Implement multi-step purification (IMAC followed by SEC and/or IEX)

    • Include stabilizing additives in all buffers

    • Minimize time between purification steps

    • Consider on-column refolding for inclusion bodies

  • Functional Verification:

    • Develop activity assays to confirm proper folding

    • Use circular dichroism to assess secondary structure

    • Compare with natively purified protein from E. coli

These approaches address the challenges of membrane protein expression and can be applied systematically to obtain functional AaeA protein for structural and functional studies. The successful strategy will depend on the specific properties of AaeA and its intended use in research .

What strategies can resolve contradictory results between in vitro and in vivo AaeA functional studies?

Resolving contradictions between in vitro and in vivo AaeA functional studies requires systematic investigation:

  • Context-Dependent Function Analysis:

    • Compare protein-protein interactions in vitro vs. in vivo

    • Assess role of membrane environment using liposomes or nanodiscs

    • Evaluate effects of physiological vs. experimental pH, ionic strength, and temperature

    • Example comparison table:

    ParameterIn Vitro ConditionIn Vivo ConditionPotential Impact
    pH7.4 (buffer)6.8-7.2 (cytoplasm)Activity modulation
    Membrane compositionDefined lipidsComplex, variableProtein conformation
    Protein partnersIsolated componentsComplete complexAllosteric regulation
    Energy sourceATP or gradientProton motive forceTransport efficiency
    Substrate concentrationμM-mM rangenM-μM rangeKinetic differences
  • Reconstitution Complexity Gradient:

    • Progress from simplified to complex systems:

      • Purified AaeA alone

      • AaeA + AaeB

      • Reconstituted in proteoliposomes

      • Membrane vesicles

      • Whole cells

    • Track functional changes at each level of complexity

  • Genetic Background Considerations:

    • Test effects of different E. coli strain backgrounds

    • Consider impact of redundant efflux systems

    • Create clean genetic backgrounds by deleting competing systems

    • Examine effects of global regulators on expression

  • Substrate Presentation Effects:

    • Compare substrate accessibility in different systems

    • Assess impact of substrate partitioning into membranes

    • Evaluate effects of substrate concentration gradients

  • Methodological Cross-Validation:

    • Apply multiple detection methods to the same system

    • Cross-validate results using orthogonal approaches

    • Standardize experimental conditions across in vitro and in vivo studies

    • Consider time-resolved studies to capture dynamic effects

This systematic approach helps identify the source of contradictions and develop a unified model of AaeA function that accounts for differences between simplified in vitro systems and the complex in vivo environment .

How can researchers distinguish the specific role of AaeA from other membrane fusion proteins in E. coli?

Distinguishing the specific role of AaeA from other membrane fusion proteins (MFPs) in E. coli requires targeted experimental approaches:

  • Comparative Genomic Analysis:

    • Analyze sequence conservation and phylogenetic distribution of AaeA vs. other MFPs

    • Compare evolutionary patterns with substrate specificities

    • Identify unique motifs or domains specific to AaeA

    • Example conservation analysis:

    MFPConserved Across E. coliPhylogroup DistributionSequence Identity Within Group
    AaeAYesAll phylogroups>90%
    AcrAYesAll phylogroups>95%
    EmrAYesAll phylogroups>85%
    EefANoOnly B2, D, E, F, G>97.7%
  • Substrate Specificity Profiling:

    • Systematically test substrate ranges of different MFP-containing pumps

    • Create a specificity matrix for various compounds

    • Identify compounds exclusively transported by AaeA-containing systems

    • Example substrate specificity matrix:

    CompoundAaeABAcrABEmrABMdtABC
    p-Hydroxybenzoic acid++++--
    Chloramphenicol-+++--
    Nalidixic acid-+++-
    Erythromycin-++-+
    Aromatic carboxylic acids++++--
  • Cross-Complementation Studies:

    • Replace AaeA with other MFPs in the efflux complex

    • Assess functional complementation

    • Identify domains responsible for specificity through chimeric proteins

    • Example complementation results:

    AaeA ComponentReplacement MFPpHBA Efflux Activity (%)
    Wild-type AaeANone100
    Deleted AaeANone<5
    Deleted AaeAAcrA<5
    Deleted AaeAEmrA<5
    AaeA-AcrA chimera (α-domain)None65
    AaeA-AcrA chimera (β-domain)None30
  • Structural Analysis:

    • Compare crystal structures or homology models of different MFPs

    • Identify unique structural features in AaeA

    • Analyze molecular dynamics simulations of substrate interactions

    • Map substrate binding sites through docking studies

  • Expression Pattern Analysis:

    • Compare expression conditions for different MFP genes

    • Analyze co-regulation patterns

    • Identify specific inducers and repressors

    • Create reporter fusions to track expression under various conditions

These approaches collectively provide a comprehensive understanding of the unique role of AaeA compared to other MFPs in E. coli. Research has shown that the AaeAB system specifically responds to and exports aromatic carboxylic acids, distinguishing it from other efflux systems with broader substrate ranges .

What emerging technologies are advancing our understanding of AaeA structure and function?

Emerging technologies are significantly enhancing our understanding of AaeA structure and function:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of the complete AaeAB complex in near-native conditions

    • Provides structural insights without crystallization

    • Captures multiple conformational states during the transport cycle

    • Reveals interactions between AaeA and other components of the efflux system

    • Resolution capabilities now approaching 2-3Å for membrane protein complexes

  • Advanced Fluorescence Techniques:

    • Single-molecule FRET to track conformational changes during substrate binding and transport

    • Super-resolution microscopy to visualize AaeA localization and clustering in the membrane

    • Fluorescence correlation spectroscopy to measure binding kinetics in real-time

    • Example data from single-molecule studies:

    Conformational StateFRET EfficiencyLifetime (ms)Observed Frequency (%)
    Resting0.25 ± 0.05150 ± 3065
    Substrate-bound0.45 ± 0.0790 ± 1525
    Transport-active0.65 ± 0.0840 ± 1010
  • Integrative Structural Biology:

    • Combining X-ray crystallography, NMR, SAXS, and computational modeling

    • Cross-linking mass spectrometry to map protein-protein interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • CRISPR-Based Approaches:

    • CRISPRi for tunable repression of aaeA and interacting genes

    • CRISPR-Cas9 base editing for precise point mutations without selection markers

    • CRISPRa for controlled overexpression studies

  • Molecular Dynamics Simulations:

    • All-atom simulations of AaeA in complex membrane environments

    • Enhanced sampling techniques to capture rare conformational changes

    • Integration with experimental data for validated models

    • Free energy calculations for substrate binding and transport

These technologies are advancing beyond the traditional approaches used in the initial characterization of the AaeAB system, offering unprecedented insights into the molecular mechanisms of substrate recognition, binding, and transport. By combining these methods, researchers can develop a comprehensive understanding of AaeA's role in aromatic carboxylic acid efflux .

How might AaeA research contribute to understanding broader principles of bacterial membrane transport?

AaeA research contributes to understanding broader principles of bacterial membrane transport in several significant ways:

  • Transport Complex Assembly Principles:

    • AaeA represents a specialized membrane fusion protein (MFP) adapted for specific substrates

    • Comparing AaeA with other MFPs (like AcrA or EefA) reveals how structural variations achieve different functionalities

    • Understanding how AaeA interacts with AaeB provides insights into general principles of transporter-MFP coupling

    • Comparison with other transport systems:

    Transport SystemComponentsSubstrate RangeAssembly Mechanism
    AaeABMFP + Efflux proteinNarrow (aromatic carboxylic acids)Bipartite
    AcrAB-TolCMFP + RND + OMFBroad (antibiotics, dyes, detergents)Tripartite
    EmrAB-TolCMFP + MFS + OMFIntermediateTripartite
    EefABCMFP + RND + OMFSpecializedTripartite
  • Substrate Specificity Determinants:

    • AaeAB's high specificity for aromatic carboxylic acids contrasts with broad-spectrum pumps

    • Provides a model for understanding how transporters achieve substrate selectivity

    • Reveals molecular features that determine substrate binding and recognition

    • Contributes to understanding the evolution of transport specificity

  • Integration of Transport with Metabolism:

    • AaeAB's proposed role as a "metabolic relief valve" illustrates how transport systems can be integrated with metabolic networks

    • Demonstrates how bacteria manage potentially toxic metabolic intermediates

    • Provides insights into the coordination between metabolic pathways and efflux systems

    • Suggests how transport systems may have evolved from metabolic roles to broader resistance functions

  • Regulatory Principles:

    • The regulation of aaeA by AaeR exemplifies substrate-responsive control mechanisms

    • Illustrates how bacteria sense and respond to specific compounds

    • Provides a model for understanding transcriptional regulation of transport systems

    • Shows how regulation is tailored to the physiological role of the transporter

  • Evolutionary Adaptations:

    • Comparison between AaeA and MFPs from RND systems like EefA reveals evolutionary divergence

    • Different conservation patterns between efflux systems reflect their distinct physiological roles

    • Provides insights into how transport systems evolve and adapt to specific ecological niches

Research on AaeA thus contributes to fundamental understanding of how bacteria regulate, assemble, and utilize specialized transport systems to maintain cellular homeostasis and respond to environmental challenges .

What are the implications of AaeA research for developing new antimicrobial strategies?

While the AaeAB system itself may not directly transport antimicrobials, research on AaeA has significant implications for developing novel antimicrobial strategies:

  • Efflux Inhibitor Development:

    • Understanding the structure and function of specialized efflux components like AaeA provides templates for rational inhibitor design

    • Targeting specific efflux systems rather than broad-spectrum inhibitors may reduce side effects

    • Comparative analysis of different MFPs can reveal common vulnerabilities

    • Example strategies for inhibitor development:

    Target SiteInhibition StrategyPotential AdvantagesDevelopment Status
    MFP-transporter interfacePeptidomimeticsDisrupts assemblyPreclinical
    MFP oligomerizationSmall moleculesPrevents channel formationEarly research
    Substrate binding pocketCompetitive inhibitorsHigh specificityIn vitro testing
    Regulatory proteinsAnti-activatorsPrevents expressionConcept stage
  • Metabolic Vulnerability Exploitation:

    • The "metabolic relief valve" function of AaeAB suggests that blocking efflux could create toxic metabolite accumulation

    • Combining metabolic perturbation with efflux inhibition could create synergistic antimicrobial effects

    • Targeting bacteria-specific metabolic-transport interfaces minimizes host toxicity

  • Virulence Modulation:

    • Research on related efflux systems like EefABC has shown connections to virulence and host colonization

    • Understanding how specialized efflux systems contribute to pathogenicity

    • Anti-virulence strategies that don't kill bacteria but reduce pathogenicity

    • Example from related research:

    Efflux SystemVirulence ContributionPotential Intervention
    EefABCGI tract colonization, pH toleranceColonization inhibitors
    AaeABMetabolic adaptationMetabolic disruptors
  • Diagnostic Applications:

    • Expression patterns of specialized efflux systems could serve as biomarkers

    • Identification of specific efflux system profiles could guide targeted antimicrobial therapy

    • Rapid detection of efflux-based resistance mechanisms

  • Novel Antimicrobial Design:

    • Understanding substrate specificity determinants enables design of antimicrobials that evade specific efflux systems

    • Creating "Trojan horse" compounds that mimic efflux substrates but deliver antimicrobial warheads

    • Engineering antimicrobials that interact with efflux systems but cannot be expelled

Research on specialized systems like AaeAB provides valuable insights into bacterial physiology and transport mechanisms that can be exploited for antimicrobial development, even when the system itself may not be directly involved in antimicrobial resistance. The knowledge gained from understanding the structure, function, and regulation of AaeA contributes to the broader toolkit for addressing bacterial infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.