Recombinant Escherichia coli Peptide transport system permease protein sapC (sapC)

Shipped with Ice Packs
In Stock

Description

Functional Role in Putrescine Export

SapC functions as a putrescine exporter, critical for maintaining intracellular polyamine homeostasis:

  • Mechanism: Utilizes ATP hydrolysis to drive putrescine efflux against concentration gradients .

  • Key Evidence:

    • ΔsapBCDF mutants showed a 50% reduction in extracellular putrescine levels compared to wild-type strains .

    • Stable isotope tracing confirmed SapBCDF-dependent export of putrescine derived from arginine metabolism .

    • Complementation with sapBCDF restored putrescine export capacity .

3.1. Genetic and Biochemical Validation

  • Knockout Studies: Deletion of sapBCDF eliminated putrescine efflux without affecting bacterial growth, indicating its non-essential role under standard conditions .

  • Proteoliposome Assays: While direct kinetic studies using proteoliposomes remain technically challenging, isotopic labeling confirmed SapBCDF’s export activity .

3.2. Comparison with Homologous Systems

OrganismSap Transporter FunctionReference
Salmonella entericaAntimicrobial peptide resistance
Escherichia coliPutrescine export under neutral pH
Haemophilus ducreyiVirulence and cationic peptide resistance

Biotechnological and Pathogenic Implications

  • Metabolic Engineering: SapBCDF could be targeted to modulate putrescine production in industrial E. coli strains .

  • Antimicrobial Resistance: While Sap systems in other pathogens confer resistance to host-defense peptides, E. coli SapBCDF appears specialized for putrescine transport .

Open Questions and Future Directions

  • Structural Resolution: High-resolution structures of SapC in complex with SapB/D/F are needed to elucidate transport mechanics.

  • Regulatory Networks: How sapBCDF expression is regulated in response to polyamine stress remains unclear.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will identify the tag type during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
sapC; b1292; JW1285; Putrescine export system permease protein SapC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
sapC
Target Protein Sequence
MPYDSVYSEKRPPGTLRTAWRKFYSDASAMVGLYGCAGLAVLCIFGGWFAPYGIDQQFLG YQLLPPSWSRYGEVSFFLGTDDLGRDVLSRLLSGAAPTVGGAFVVTLAATICGLVLGTFA GATHGLRSAVLNHILDTLLAIPSLLLAIIVVAFAGPSLSHAMFAVWLALLPRMVRSIYSM VHDELEKEYVIAARLDGASTLNILWFAVMPNITAGLVTEITRALSMAILDIAALGFLDLG AQLPSPEWGAMLGDALELIYVAPWTVMLPGAAIMISVLLVNLLGDGVRRAIIAGVE
Uniprot No.

Target Background

Function
This protein is part of a putrescine export transport system in Escherichia coli. It does not play a role in resistance to antimicrobial peptides.
Gene References Into Functions
  1. Research findings strongly suggest that the SapBCDF proteins naturally function in the export of putrescine. PMID: 27803167
Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the peptide transport system permease protein SapC in E. coli?

SapC is a membrane-bound component of the peptide transport system in Escherichia coli, functioning as a permease protein. It spans 296 amino acids (1-296aa) and plays a critical role in the transport mechanism for specific peptides across the bacterial membrane. The protein is encoded by the sapC gene and has been assigned the UniProt identifier P0AGH5. In recombinant systems, it is commonly expressed with affinity tags such as His-tag to facilitate purification and characterization studies .

What are the key structural domains of SapC and how do they contribute to its function?

The SapC protein contains multiple transmembrane domains characteristic of permease proteins in ATP-binding cassette (ABC) transport systems. While the specific structural details of SapC require further investigation through techniques like X-ray crystallography or cryo-EM, comparative analysis with similar permease proteins suggests the presence of substrate-binding domains and interaction interfaces with other components of the transport complex. These structural features are essential for the formation of membrane channels that facilitate peptide transport across the bacterial cell membrane.

How does recombinant SapC differ from native SapC protein?

Recombinant SapC typically contains modifications to facilitate expression, purification, and characterization. The most common modification is the addition of a histidine tag (His-tag), usually at the N-terminus, which enables purification using metal affinity chromatography. The recombinant version expressed in E. coli systems maintains the full-length sequence (1-296aa) of the native protein but may demonstrate different folding characteristics or post-translational modifications depending on the expression system used . Researchers should be aware that these modifications may influence protein conformation and function in experimental settings.

What are the optimal expression systems for producing recombinant SapC protein?

The most commonly used expression system for recombinant SapC is E. coli, as it provides several advantages for membrane protein production including rapid growth, high protein yields, and genetic tractability. Based on established protocols for similar membrane proteins, E. coli BL21(DE3) or its derivatives are frequently employed for sapC expression. Expression vectors containing T7 or tac promoters provide controlled induction using IPTG (Isopropyl β-d-1-thiogalactopyranoside). For enhanced membrane protein expression, specialized E. coli strains like C41(DE3) or C43(DE3) may yield better results as they are designed to accommodate potentially toxic membrane proteins .

What methods can be used to generate recombinant SapC constructs with site-specific modifications?

For generating recombinant SapC with site-specific modifications, several genetic engineering approaches can be employed:

  • Lambda Red (λ-Red) recombination coupled with I-SceI cleavage provides a high-efficiency, scarless method for introducing modifications into the chromosomal sapC gene. This two-plasmid system involves creating an intermediate strain with resistance markers and I-SceI recognition sites near the target gene, followed by transformation with a donor plasmid carrying the desired modification .

  • Site-directed mutagenesis can be performed using techniques such as overlap extension PCR or QuikChange mutagenesis to introduce specific amino acid substitutions, deletions, or insertions.

  • For domain-specific studies, researchers can design constructs with partial deletions or domain swaps using PCR-based methods with appropriate primers to amplify and fuse specific regions of interest .

What purification strategies yield the highest purity and activity for recombinant His-tagged SapC?

Purification of His-tagged SapC requires specialized approaches due to its membrane protein nature. The recommended purification workflow includes:

  • Membrane Fraction Isolation: Cells expressing SapC should be harvested by centrifugation (8,000 × g, 10 min, 4°C), resuspended in buffer containing protease inhibitors, and disrupted by sonication or mechanical lysis .

  • Detergent Solubilization: The membrane fraction containing SapC should be solubilized using appropriate detergents such as n-dodecyl β-D-maltoside (DDM), n-octyl glucoside (OG), or digitonin at concentrations above their critical micelle concentration.

  • Immobilized Metal Affinity Chromatography (IMAC): The solubilized protein can be purified using Ni-NTA or Co-NTA resins with imidazole gradient elution, maintaining detergent concentrations above CMC throughout.

  • Size Exclusion Chromatography: A final polishing step using size exclusion chromatography helps remove aggregates and ensures homogeneity of the purified protein.

Typical purification yields should be assessed by SDS-PAGE analysis and Western blotting using anti-His antibodies, with expected molecular weight of approximately 32-35 kDa (accounting for the His-tag).

How can researchers design experiments to investigate SapC-substrate interactions?

Investigating SapC-substrate interactions requires multifaceted experimental approaches:

  • Binding Assays: Isothermal Titration Calorimetry (ITC) or Surface Plasmon Resonance (SPR) can quantify binding affinities between purified SapC and potential peptide substrates. For ITC, purified SapC in detergent micelles can be titrated with increasing concentrations of substrate peptides to determine thermodynamic parameters.

  • Transport Assays: Reconstitution of SapC into proteoliposomes allows for transport assays using fluorescently labeled peptides or radiolabeled substrates. Uptake can be measured over time and kinetic parameters determined.

  • Crosslinking Studies: Photo-affinity labeling with modified substrates containing photo-reactive groups can identify specific substrate binding sites. After UV-induced crosslinking, the protein-substrate complex can be analyzed by mass spectrometry to identify interaction sites.

  • Mutagenesis Approach: Based on computational predictions or sequence alignments, key residues potentially involved in substrate binding can be mutated (using the λ-Red recombination system ), and the effects on substrate binding and transport can be evaluated.

What techniques can be used to study the membrane topology and structure of SapC?

Understanding the membrane topology and structure of SapC requires specialized techniques for membrane protein analysis:

  • Cysteine Scanning Mutagenesis: Introducing cysteine residues at different positions throughout the protein followed by accessibility assays with membrane-impermeable sulfhydryl reagents can map regions exposed to different cellular compartments.

  • Protease Protection Assays: Limited proteolysis of SapC in membrane vesicles or proteoliposomes, followed by mass spectrometry, can identify accessible regions and help determine topology.

  • Fluorescence Resonance Energy Transfer (FRET): By introducing fluorescent probes at specific sites, FRET can measure distances between domains and monitor conformational changes during transport cycles.

  • Cryo-Electron Microscopy: For high-resolution structural studies, purified SapC can be reconstituted into nanodiscs or analyzed in detergent micelles using single-particle cryo-EM.

  • Molecular Dynamics Simulations: Computational approaches can model SapC structure in membrane environments, providing insights into dynamics and potential conformational changes during transport.

How can researchers investigate the interaction of SapC with other components of the peptide transport system?

To study interactions between SapC and other components of the peptide transport system:

  • Co-immunoprecipitation: Using antibodies against SapC or its interacting partners, researchers can pull down protein complexes from solubilized membranes and identify components by Western blotting or mass spectrometry.

  • Bacterial Two-Hybrid Assays: This genetic approach can screen for protein-protein interactions in vivo. The SapC protein or specific domains can be fused to one part of a split reporter protein while potential interacting partners are fused to the complementary part.

  • Pull-down Assays: His-tagged SapC can be used as bait to identify interacting proteins from cell lysates, with subsequent identification by mass spectrometry.

  • Cross-linking Coupled with Mass Spectrometry: Chemical cross-linkers can stabilize transient interactions between SapC and other components, and cross-linked peptides can be identified by mass spectrometry to map interaction interfaces.

  • Genetic Approaches: Suppressor mutation analysis or synthetic lethality screens can identify functional relationships between SapC and other proteins in vivo.

What are the most effective methods for introducing mutations in the sapC gene for structure-function studies?

For structure-function studies of SapC, several mutation strategies can be employed:

  • Lambda Red Recombination System: This highly efficient method allows for scarless genetic modifications in E. coli chromosomes. The approach uses a two-plasmid system involving λ-Red recombination and I-SceI cleavage :

    • First, create an intermediate strain by integrating resistance markers and I-SceI recognition sites near the sapC gene locus

    • Transform this strain with a donor plasmid carrying the sapC fragment with desired mutations

    • Express both λ-Red recombination enzymes and I-SceI endonuclease to facilitate precise recombination

  • Site-Directed Mutagenesis on Plasmid-Borne sapC: For plasmid-based expression systems, standard site-directed mutagenesis techniques can be applied to introduce specific mutations. After verification by sequencing, the mutant constructs can be expressed in appropriate E. coli strains .

  • CRISPR-Cas9 Genome Editing: For chromosomal modifications, CRISPR-Cas9 systems adapted for bacterial genome editing provide precise targeting and modification of the sapC gene.

How can researchers design complementation experiments to verify SapC function?

Complementation experiments are crucial for confirming the functionality of recombinant or mutant SapC proteins:

  • Construction of sapC Knockout Strain: Create a sapC deletion strain using methods such as λ-Red recombination with a kanamycin resistance cassette insertion, as described for other E. coli genes .

  • Phenotypic Characterization: Determine the phenotype of the sapC knockout strain, which may include altered peptide uptake, sensitivity to specific environmental conditions, or growth defects on certain media.

  • Complementation Vector Construction: Clone the wild-type or mutant sapC gene into an appropriate expression vector with a controlled promoter (such as arabinose-inducible pBAD or IPTG-inducible pET systems).

  • Functional Rescue Analysis: Transform the knockout strain with complementation vectors and assess restoration of function through:

    • Growth assays under selective conditions

    • Transport assays using labeled peptide substrates

    • Resistance to toxic peptides that may enter through the Sap transport system

  • Quantitative Assessment: Measure the degree of functional complementation using quantitative assays and compare wild-type and mutant SapC variants to identify critical residues or domains.

What approaches can be used to study the regulation of sapC gene expression?

To investigate the regulation of sapC gene expression, researchers can implement the following approaches:

  • Transcriptional Fusions: Create sapC-reporter gene fusions (such as sapC-lacZ) to monitor promoter activity under various conditions. This approach allows for quantitative assessment of transcriptional regulation by measuring β-galactosidase activity .

  • Primer Extension Analysis: Determine the transcription start site of the sapC gene using primer extension techniques, which can help identify the core promoter elements. Design appropriate primers that anneal downstream of the predicted transcription start site and generate cDNA from isolated RNA using reverse transcriptase .

  • Electrophoretic Mobility Shift Assays (EMSA): Identify proteins that bind to the sapC promoter region using purified transcription factors or cell extracts. DNA fragments containing the promoter region can be labeled and incubated with potential regulatory proteins.

  • Chromatin Immunoprecipitation (ChIP): For in vivo analysis of protein-DNA interactions, ChIP can identify transcription factors that bind to the sapC promoter under specific conditions.

  • Deletion Analysis: Create a series of promoter deletions to identify regulatory elements important for sapC expression. These constructs can be fused to reporter genes and analyzed for activity under different conditions.

What methods are most effective for assessing the transport activity of recombinant SapC in vitro?

To evaluate the transport activity of recombinant SapC in vitro, researchers can employ these methodologies:

  • Proteoliposome Reconstitution: Purified SapC, along with other components of the transport system (SapA, SapB, SapD, SapF), can be reconstituted into liposomes to create a functional transport system. The protein-to-lipid ratio should be optimized for maximum activity.

  • Fluorescence-Based Transport Assays: Encapsulate fluorescent substrates or pH-sensitive fluorophores within proteoliposomes to monitor transport activity. Changes in fluorescence can be measured in real-time using spectrofluorometry.

  • Radioactive Transport Assays: Using radiolabeled peptide substrates (e.g., ³H or ¹⁴C-labeled peptides), measure the accumulation of radioactivity inside proteoliposomes over time. Samples can be collected through rapid filtration and quantified by scintillation counting.

  • Electrochemical Measurements: For transport systems coupled to ion movement, reconstitute SapC in planar lipid bilayers and measure electrical currents associated with transport activity using patch-clamp techniques.

  • Stopped-Flow Spectroscopy: Rapid kinetic measurements can capture the initial rates of transport and conformational changes in SapC using fluorescent substrates or labeled protein.

How can researchers differentiate between direct effects on SapC and indirect effects on the transport system when analyzing mutant phenotypes?

Differentiating direct effects on SapC from indirect effects on the transport system requires systematic analysis:

  • Protein Expression and Stability Assessment: Verify that mutations do not affect SapC expression levels or stability by Western blot analysis with anti-SapC or anti-His antibodies for tagged constructs.

  • Membrane Localization Studies: Use cell fractionation followed by Western blotting or fluorescence microscopy with GFP-tagged SapC variants to confirm proper membrane localization of mutant proteins.

  • Isolated Component Analysis: Express and purify individual components (including mutant SapC) and reconstitute them in different combinations to identify which specific interactions or functions are affected.

  • Cross-linking Studies: Compare cross-linking patterns between wild-type and mutant SapC with other transport system components to identify altered protein-protein interactions.

  • Direct Binding Assays: Measure substrate binding to purified wild-type and mutant SapC proteins using techniques like isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to distinguish transport defects from binding defects.

  • Complementation Analysis with Chimeric Proteins: Create domain-swapped chimeras between SapC and related permeases to identify functional domains and assess their contribution to observed phenotypes.

What are the current challenges and future directions in studying recombinant SapC and its role in bacterial physiology?

Current challenges and future research directions for SapC include:

  • Structural Determination: Despite advances in membrane protein structural biology, high-resolution structures of SapC alone or in complex with other Sap components remain elusive. Future efforts should focus on cryo-EM or X-ray crystallography approaches optimized for membrane protein complexes.

  • Substrate Specificity: The precise range of peptides transported by the Sap system, and the specific role of SapC in substrate selection, remains incompletely characterized. Comprehensive substrate screening using peptide libraries coupled with transport assays could address this gap.

  • Physiological Relevance: The role of SapC and the Sap transport system in bacterial stress responses, virulence, and antibiotic resistance requires further investigation through in vivo studies under various environmental conditions.

  • Potential as Drug Target: Exploring SapC as a potential target for novel antimicrobials requires understanding its structure-function relationships and developing high-throughput screening assays for inhibitor discovery.

  • Integration with Systems Biology: Understanding how SapC function integrates with global cellular processes requires combining traditional biochemical approaches with systems biology techniques such as transcriptomics, proteomics, and metabolomics.

Current ChallengeFuture DirectionMethodological Approach
Limited structural informationHigh-resolution structure determinationCryo-EM of SapC in nanodiscs or lipid environments
Incomplete understanding of substrate specificityComprehensive substrate profilingHigh-throughput transport assays with peptide libraries
Unclear physiological roleIn vivo functional characterizationTranscriptomics and phenotypic analysis under various stress conditions
Limited tools for studying membrane dynamicsDevelopment of new biophysical approachesSingle-molecule tracking and advanced microscopy techniques
Integration with other transport systemsSystems-level analysisMulti-omics approaches combined with network analysis

What are common challenges in expressing recombinant SapC and how can they be addressed?

Expressing membrane proteins like SapC presents several challenges that researchers commonly encounter:

  • Toxicity and Low Expression Yields: Overexpression of membrane proteins often leads to toxicity and growth inhibition.

    • Solution: Use tightly controlled inducible promoters (like arabinose-inducible pBAD) and optimize induction conditions (lower temperature, reduced inducer concentration, shorter induction time).

    • Alternative: Consider specialized E. coli strains designed for membrane protein expression (C41/C43, Lemo21) or cell-free expression systems.

  • Protein Misfolding and Aggregation: Improper folding can lead to inclusion body formation.

    • Solution: Express at lower temperatures (16-20°C) and add folding enhancers like glycylbetaine or sorbitol to the growth medium.

    • For Recovery: If inclusion bodies form, optimize refolding protocols using mild detergents and gradual dialysis.

  • Proteolytic Degradation: Unstable membrane proteins may be susceptible to proteolysis.

    • Solution: Use protease-deficient strains (like BL21) and include protease inhibitors during all purification steps.

    • Analysis: Monitor degradation by Western blotting and optimize buffer conditions to enhance stability.

  • Poor Solubilization: Inefficient extraction from membranes.

    • Solution: Screen multiple detergents (DDM, LMNG, digitonin) at various concentrations for optimal solubilization while maintaining protein function.

    • Alternative Approach: Consider using styrene-maleic acid copolymer (SMA) to extract SapC in native lipid nanodiscs.

How can researchers resolve experimental contradictions in SapC functional studies?

When faced with contradictory results in SapC functional studies, consider these systematic approaches:

What quality control measures are essential when working with recombinant SapC preparations?

To ensure reliable and reproducible results with recombinant SapC, implement these quality control measures:

  • Protein Purity Assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (aim for >90% purity)

    • Western blotting with anti-SapC or anti-His antibodies

    • Size exclusion chromatography to assess monodispersity and aggregation state

  • Structural Integrity Verification:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Fluorescence spectroscopy to assess tertiary structure (if tryptophan residues are present)

    • Thermal stability assays (differential scanning fluorimetry) to measure protein stability

  • Functional Validation:

    • Substrate binding assays (using fluorescence anisotropy or ITC)

    • ATPase activity measurements (if reconstituted with ATP-binding components)

    • Transport assays in proteoliposomes with established substrates

  • Membrane Incorporation Assessment:

    • Sucrose density gradient centrifugation to verify incorporation into liposomes

    • Freeze-fracture electron microscopy to visualize protein distribution in membranes

    • Fluorescence quenching assays to confirm proper orientation in membrane

  • Batch Consistency Monitoring:

    • Maintain detailed records of expression and purification conditions

    • Create internal standards for activity assays

    • Implement regular quality checks using established benchmarks

  • Storage Stability Testing:

    • Monitor protein stability under different storage conditions

    • Perform functional assays before and after storage periods

    • Establish maximum storage duration guidelines based on empirical data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.