Recombinant Escherichia coli Phage shock protein C (pspC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Phage Shock Protein C (PspC)

The phage shock protein (Psp) response is a crucial mechanism in bacteria, particularly in maintaining cell membrane integrity when the cell faces stressful conditions . This system is essential for survival during the stationary phase, maintaining the proton motive force across membranes, and has links to virulence . Originally discovered during studies of filamentous phage f1 infection in E. coli, the Psp response involves several proteins, including PspC .

Overview of the Psp System

The Psp system, well-studied in Escherichia coli and Yersinia enterocolitica, includes proteins such as PspF, -A, -B, and -C, all associated with significant bacterial phenotypes, including virulence in Y. enterocolitica . These proteins are critical for the bacterial response to stress and the maintenance of cell membrane integrity .

Role and Function of PspC

PspC is a cytoplasmic membrane protein required for the stress-dependent induction of psp gene expression and for bacterial survival when outer membrane secretin proteins are mislocalized . Specifically, PspC, along with PspB, plays a vital role in inducing the Yersinia enterocolitica Psp stress response .

PspC as a Polytopic Membrane Protein

Research indicates that PspC is a polytopic membrane protein, meaning that both its N-terminus and C-terminus are located in the cytoplasm . This contrasts with earlier models suggesting it was a bitopic membrane protein with its C-terminus located outside the cell . This arrangement allows for a new understanding of how the Psp response is activated .

Interaction with FtsH Protease

The cytoplasmic membrane protease FtsH destabilizes PspC in Y. enterocolitica . The co-production of PspC with its binding partner, PspB, can prevent this destabilization, suggesting that FtsH acts as a quality control mechanism to remove excess or uncomplexed PspC, which might be harmful to the cell .

FtsH-Dependent Degradation of PspC

FtsH destabilizes PspC when it is produced in excess relative to its binding partner, PspB . Uncomplexed PspC is likely a degradation substrate for FtsH . This is similar to other cytoplasmic membrane proteins like SecY and AtpB in E. coli, which are degraded by FtsH when they are not properly assembled into complexes .

Impact of PspC on Bacterial Virulence

In Yersinia enterocolitica, the Psp system, including PspC, is linked to virulence . The precise mechanisms by which PspC contributes to virulence are still being investigated, but its role in maintaining membrane integrity under stress conditions is likely significant .

Experimental Evidence for PspC Topology

Various experimental approaches have confirmed that both termini of PspC are located in the cytoplasm . These experiments also suggest that the C-terminus of PspC may be the recognition site for the FtsH protease and an interaction interface with PspA .

PspC and Membrane Stress Management

The Psp response, including PspC, helps cells manage agents that impair cell membrane function . This response is not limited to E. coli and can be induced by various conditions that compromise membrane integrity .

Role of PspC in Phage Infections

During phage infections, such as those by Microviridae bacteriophage φX174, E. coli undergoes significant stress . The host response involves membrane damage and remodeling, and the upregulation of heat shock proteins, suggesting that proteins like PspC may play a role in the bacterial response to these infections .

Data Table: Key Features of PspC

FeatureDescription
Protein TypeCytoplasmic membrane protein
FunctionInduces Psp stress response; maintains membrane integrity
TopologyPolytopic; both N-terminus and C-terminus in the cytoplasm
InteractionInteracts with PspB and PspA
RegulationDestabilized by FtsH protease when uncomplexed; stabilized by PspB
Role in VirulenceContributes to virulence in Yersinia enterocolitica
Involvement in Phage ShockPart of the broader phage shock response, aiding in managing membrane stress during phage infection

Research Findings on PspC

FindingDescriptionReference
PspC TopologyBoth N- and C-termini of PspC are located in the cytoplasm, challenging previous bitopic models.
FtsH Protease InteractionFtsH destabilizes PspC when it is not complexed with PspB, suggesting a quality control mechanism.
Role in Stress ResponsePspC is crucial for inducing the Psp stress response, which is vital for maintaining membrane integrity under stress.
Involvement in Bacterial VirulencePspC contributes to the virulence of Yersinia enterocolitica, likely through its role in stress response and membrane maintenance.
Response to Phage InfectionDuring phage infection, PspC may be involved in the host response to membrane damage and stress, alongside other heat shock proteins.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pspC; b1306; JW1299; Phage shock protein C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
pspC
Target Protein Sequence
MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIIL SFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL
Uniprot No.

Target Background

Function
The phage shock protein (psp) operon (pspABCDE) plays a significant role in bacterial survival under nutrient or energy stress. PspC is involved in transcriptional regulation.
Gene References Into Functions
  1. FtsH degrades phage shock protein C in Escherichia coli. PMID: 21965563
Database Links
Protein Families
Phageshock PspC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Phage Shock Protein (Psp) system in E. coli and what role does PspC play?

The Psp system is one of five major extracytoplasmic stress signaling pathways in E. coli (alongside Bae, Cpx, Rcs, and σE) that detect and respond to alterations in the bacterial envelope. Originally discovered during filamentous phage f1 infection, the system is encoded by the pspABCDE operon and the physically separated pspF and pspG genes . PspC functions as a critical positive regulator within this system and, together with PspB, acts as a sensory component for specific stressors . Both proteins cooperatively activate expression of the psp operon, with the strength of activation primarily determined by PspC concentration, while PspB enhances but is not absolutely essential for PspC-dependent expression .

The Psp response is transcriptionally regulated through both positive and negative feedback mechanisms:

RegulatorFunction in Psp System
PspANegative regulator (binds PspF to prevent transcription)
PspBEnhances PspC-dependent activation
PspCPrimary positive regulator/sensor
PspFTranscriptional activator (σ54-dependent)

How is recombinant PspC typically expressed in laboratory settings?

Recombinant PspC can be expressed using various expression vectors in E. coli. The expression typically involves:

  • Cloning the pspC gene into an appropriate expression vector under control of an inducible promoter (such as lac or trc)

  • Transformation into a suitable E. coli strain

  • Induction of expression using the appropriate inducer (e.g., IPTG for lac-based systems)

For improved secretion and purification, researchers often use signal sequences to direct PspC to specific cellular compartments. According to the literature, several signal sequences have been successfully used:

Signal SequenceOriginTarget LocationProperties
bla SSβ-lactamasePeriplasmEffective for type II secretion
ompA SSOuter membrane protein APeriplasmCommon for recombinant proteins
phoA SSAlkaline phosphatasePeriplasmUsed for efficient secretion
bla SS+CTβ-lactamase with C-terminal peptideSecretedEnhances extracellular release

For challenging expression scenarios, specialized E. coli strains like C41(DE3) and C43(DE3) can be used, as they were specifically selected to withstand the expression of potentially toxic membrane proteins .

What are the most effective methods for inducing and measuring the Psp response in experimental settings?

The Psp response can be induced by various stressors, with the most effective inducers being:

  • Secretin production: The prolonged synthesis of phage secretins (e.g., pIV from filamentous phage f1) leads to continual and abundant production of PspA and activation of the Psp response .

  • Membrane stress conditions: Ethanol treatment, osmotic shock (NaCl addition), and extreme heat shock can all induce the Psp response to varying degrees .

To measure Psp response activation, researchers commonly use:

  • Immunoprecipitation with anti-PspA serum: This allows monitoring of 35S-labeled PspA production in response to various stressors and genetic manipulations .

  • Transcriptional reporter fusions: Linking the psp promoters to reporter genes like lacZ or GFP enables quantitative measurement of transcriptional activation .

  • Western blot analysis: For detecting PspC and other Psp proteins directly .

Experimental data shows differential requirements for PspC in various stress conditions:

Stress ConditionPspC RequirementNotes
Phage infectionStrictly requiredPspB also required
Osmotic shockPartially requiredResponse reduced but not eliminated in ΔpspC strains
Ethanol treatmentPartially requiredResponse reduced but not eliminated in ΔpspC strains
Heat shockNot requiredPspA synthesis still strong in ΔpspC strains

How can I optimize the solubility of recombinant PspC to prevent inclusion body formation?

Preventing inclusion body formation during recombinant PspC expression requires a multi-faceted approach:

  • Growth conditions optimization:

    • Lower induction temperature (16-25°C)

    • Reduced inducer concentration

    • Slower induction using auto-induction media

  • Vector engineering:

    • Fusion with solubility-enhancing tags (e.g., MBP, SUMO, TrxA)

    • Use of protease-cleavable tags to remove the fusion partner after purification

    • Optimization of signal sequences for proper subcellular localization

  • Host strain selection:

    • BL21(DE3) derivatives optimized for membrane protein expression

    • Strains with enhanced chaperone expression

    • C41(DE3) and C43(DE3) strains specifically selected for toxic protein expression

  • Co-expression strategies:

    • Co-express with chaperones to aid proper folding

    • Co-express with PspA which might help maintain membrane integrity during expression

Research has shown that co-expression of PspA can relieve secretion saturation of the Tat pathway, suggesting that the Psp system plays a role in maintaining membrane function during high-level recombinant protein expression .

How does the predicted leucine zipper motif in PspC contribute to its function in signal transduction?

PspC contains a predicted leucine zipper motif, a structural feature common in transcriptional activators that facilitates protein dimerization . This motif likely plays several key roles in PspC function:

  • Protein-protein interactions: The leucine zipper likely mediates interaction with PspB, allowing cooperative activation of the psp operon in response to stress signals .

  • Sensing membrane stress: The structural characteristics of the leucine zipper may be involved in detecting alterations in membrane properties during stress conditions.

  • Signal transduction: Upon detecting membrane stress, the leucine zipper domain may undergo conformational changes that propagate the signal to activate the transcriptional response.

Experimental evidence supports that PspC functions as part of a regulatory network involving PspB and PspA:

  • PspC overexpression can activate the psp operon even in the absence of stress

  • The strength of activation is determined primarily by PspC concentration

  • PspB enhances but is not absolutely essential for PspC-dependent expression

Understanding the molecular details of how this structural motif contributes to stress sensing and signal transduction represents an important area for advanced research.

What are the mechanistic differences in PspC-dependent and PspC-independent activation of the Psp response?

Research has revealed distinct mechanistic pathways for Psp response activation that differ in their requirement for PspC:

PspC-dependent activation (during phage infection, osmotic shock, ethanol treatment):

  • Requires both PspB and PspC sensors

  • Signal is detected at the membrane level

  • Involves antagonizing PspA-controlled repression

  • Activation strength is primarily determined by PspC concentration

PspC-independent activation (during extreme heat shock or under anaerobic conditions):

  • Does not require PspB and PspC

  • Signal may be recognized directly by PspA

  • Likely involves direct effects on membrane properties that release PspF from PspA inhibition

  • May utilize different promoter elements or regulatory factors

Understanding these distinct activation mechanisms could lead to more precise experimental control of the Psp response and better insight into bacterial stress adaptation strategies.

How can transcriptomic data be used to distinguish between direct and indirect effects of PspC overexpression?

Analyzing transcriptomic data to distinguish direct from indirect effects of PspC overexpression requires a systematic approach:

  • Direct PspC targets identification:

    • Compare transcriptome changes upon PspC overexpression with known PspF binding sites

    • Focus on genes with σ54-dependent promoters, as PspF is a σ54 enhancer-binding protein

    • Look for UAS (upstream activating sequences) similar to those in pspA and pspG promoters

  • Secondary effect differentiation:

    • Use time-course experiments to distinguish immediate (likely direct) from delayed (likely indirect) effects

    • Compare with transcriptome changes induced by other Psp components (e.g., PspF overexpression)

    • Apply bioinformatic approaches to identify regulatory motifs in upregulated genes

Research has shown that PspF overexpression primarily induces:

  • The pspABCDE operon and pspG

  • Genes involved in maintaining proton motive force (e.g., tolB, hyfR)

  • Genes related to nitric oxide reduction (e.g., norW)

A table of known transcriptional changes upon PspF overexpression:

Gene/OperonFunctionFold ChangePathway
pspABCDEPhage shock responseStrongly inducedDirect PspF target
pspGPhage shock responseStrongly inducedDirect PspF target
tolBCell envelope integrityDerepressedMaintaining PMF
hyfRProton-translocating formate hydrogenaseDerepressedMaintaining PMF
norWNitric oxide reductionStrongly up-regulatedσ54-regulated

How do you reconcile contradictory results regarding PspC's role in different stress conditions?

Researchers sometimes encounter apparently contradictory results regarding PspC's role in various stress conditions. This can be systematically addressed by:

  • Strain-specific variation analysis:

    • Different E. coli strains show variable sensitivity to osmotic stress (e.g., strain L1 induces Psp proteins more vigorously than K38 at lower salt concentrations)

    • The deletion of pspC from L1 (creating L32) completely abolishes psp expression in response to 0.3 M NaCl, while in other strains it merely reduces the response

  • Growth condition standardization:

    • Aerobic vs. anaerobic conditions significantly affect Psp response mechanisms

    • PspC importance varies between microaerobic and fully aerobic conditions

  • Experimental method consistency:

    • Different methods for detecting Psp activation (e.g., immunoprecipitation, reporter fusions, Western blotting) may have varying sensitivities

    • Quantitative techniques should be used to measure the degree of PspC dependence rather than making binary (required/not required) assessments

  • Reconciliation framework:

    • Consider PspC as part of a complex regulatory network with redundant pathways

    • Propose a unified model that accounts for varying PspC requirements under different conditions

For example, while heat shock can induce the Psp response independent of PspC, the presence of PspC might still enhance the magnitude or sustainability of the response.

How is recombinant PspC being utilized in vaccine development against Streptococcus pneumoniae?

It's important to note a distinction between E. coli PspC (part of the phage shock protein system) and Streptococcus pneumoniae PspC (pneumococcal surface protein C). The latter is being investigated as a vaccine antigen:

Pneumococcal PspC is a surface protein with dual functions:

  • Binds factor H (FH) of the complement system

  • Binds secretory IgA (sIgA) via the secretory component

Research has shown that recombinant pneumococcal PspC can be effectively expressed in E. coli and used in vaccine development:

  • Expression optimization:

    • Various signal sequences (bla SS, ompA SS, phoA SS, bla SS+CT) have been tested for optimal expression and secretion

    • The bla SS+CT-pspC fusion yielded the largest amounts of secreted PspC

  • Vaccine delivery systems:

    • Recombinant attenuated Salmonella vaccines (RASVs) have been used to express and deliver PspC to host mucosal tissues

    • Different signal sequences affect the immune response to the expressed antigen

  • Immune response data:

    • Strains carrying the bla SS+CT-pspC fusion induced the highest serum IgG titers in mice

    • This correlated with greater protection against S. pneumoniae challenge

These findings demonstrate how understanding recombinant protein expression systems can be applied to practical vaccine development strategies.

What are the evolutionary implications of the conserved mechanisms of the Psp response across bacterial species?

The conservation of the Psp response across bacterial species has significant evolutionary implications:

  • Functional conservation:

    • The role of PspA protein in maintaining proton motive force appears conserved even in distant bacterial species

    • The Synechocystis sp. strain PCC6803 PspA homologue, VIPP1, can functionally substitute for E. coli PspA in enhancing Tat pathway protein export

  • Regulatory divergence:

    • Despite functional conservation, the regulatory mechanisms show species-specific adaptations

    • The complete network of five extracytoplasmic stress signaling pathways (Bae, Cpx, Psp, Rcs, and σE) shows little overlap in transcriptional responses, suggesting complementary functions integrated to mount a full adaptive response

  • Implications for stress adaptation:

    • The membrane stress response appears to be a fundamental requirement for bacterial survival

    • Different bacterial species may have evolved specialized versions of the Psp system to address their specific environmental challenges

This evolutionary conservation highlights the fundamental importance of membrane integrity maintenance systems in bacterial survival and adaptation to environmental stresses.

What are common challenges in purifying recombinant PspC and how can they be addressed?

Purification of recombinant PspC presents several challenges due to its membrane association and potential for aggregation:

  • Solubility issues:

    • Challenge: PspC tends to form inclusion bodies when overexpressed

    • Solution: Use solubility tags (MBP, SUMO), lower induction temperature, or specialized solubilization buffers containing mild detergents

  • Membrane association:

    • Challenge: PspC's association with the membrane makes extraction difficult

    • Solution: Test different detergents (DDM, LDAO, Triton X-100) for optimal extraction while maintaining protein structure

  • Protein stability:

    • Challenge: PspC may be unstable during purification procedures

    • Solution: Include protease inhibitors, optimize buffer conditions (pH, salt concentration), and keep samples cold throughout purification

  • Functionality assessment:

    • Challenge: Ensuring purified PspC retains its native structure and function

    • Solution: Develop functional assays based on PspC's ability to interact with PspB or activate the psp operon

A methodological approach to optimize purification:

Purification StageCommon IssuesOptimization Strategies
Cell lysisIncomplete extractionTest different lysis methods (sonication, French press, detergent-based)
Inclusion body handlingPoor solubilization or refoldingGradual dilution, on-column refolding, chaperone addition
Affinity chromatographyNon-specific bindingOptimize wash conditions, use more specific tags
Tag removalInefficient cleavageTest different proteases, optimize cleavage conditions
Final polishingAggregationSize exclusion chromatography in stabilizing buffers

How can researchers distinguish between the effects of PspC overexpression and general stress responses in E. coli?

Distinguishing PspC-specific effects from general stress responses requires careful experimental design:

  • Appropriate controls:

    • Use strains overexpressing irrelevant proteins at similar levels

    • Include PspA overexpression controls to compare with PspC effects

    • Use PspC mutants lacking specific functional domains

  • Genetic approach:

    • Perform experiments in strains lacking other stress response pathways (ΔrpoS, ΔrpoH, ΔrpoE)

    • Use double mutants (e.g., ΔpspA/ΔpspC) to distinguish redundant effects

    • Employ CRISPR-Cas9 to create precise mutations in regulatory regions

  • Temporal analysis:

    • Monitor gene expression changes over time to distinguish immediate (direct) from delayed (indirect) effects

    • Compare kinetics of PspC-induced responses with known stress response kinetics

  • Specificity validation:

    • Analyze promoter occupancy using ChIP-seq to identify direct regulatory targets

    • Use transcriptomics to compare PspC-induced gene expression with established stress regulons

    • Perform epistasis experiments to determine genetic hierarchies

Recent research has shown that different extracytoplasmic stress signaling pathways (Bae, Cpx, Psp, Rcs, and σE) show surprisingly little overlap in their transcriptional responses , suggesting that careful experimental design can effectively distinguish PspC-specific effects from general stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.